KEGG   Homo sapiens (human): 900Help
Entry
900               CDS       T01001                                 

Gene name
CCNG1, CCNG
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    900 (CCNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    900 (CCNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 900
NCBI-ProteinID: NP_004051
OMIM: 601578
HGNC: 1592
Ensembl: ENSG00000113328
Vega: OTTHUMG00000130380
Pharos: P51959(Tbio)
UniProt: P51959
LinkDB All DBs
Position
5q34
AA seq 295 aa AA seqDB search
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtactgacaacaactgactctcagaaactgctacaccagctgaatgccctg
ttggaacaggagtctagatgtcagccaaaggtctgtggtttgagactaattgagtctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacagagacattttctctagctgtgaatttactg
gacagattcctgtctaaaatgaaggtacagcccaagcaccttgggtgtgttggactgagc
tgcttttatttggctgtaaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagtcaatataggtttacggtttcagacttgatgagaatggaaaagatt
gtattggagaaggtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactg
tattattcactccttcaagagaacttgccacttgaaaggagaaatagcattaattttgaa
agactagaagctcaactgaaggcatgtcattgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcattagagatccaagcacagaagtgtgtagagtta
acagaaggaatagaatgtcttcagaaacattccaagataaatggcagagatctgaccttc
tggcaagagcttgtatccaaatgtttaactgaatattcatcaaataagtgttccaaacca
aatgttcagaagttgaaatggattgtttctgggcgtactgcacggcaattgaagcatagc
tactacagaataactcaccttccaacaattcctgaaatggtcccttaa

DBGET integrated database retrieval system