KEGG   Homo sapiens (human): 901Help
Entry
901               CDS       T01001                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    901 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    901 (CCNG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 901
NCBI-ProteinID: NP_004345
OMIM: 603203
HGNC: 1593
Ensembl: ENSG00000138764
Vega: OTTHUMG00000130100
Pharos: Q16589(Tbio)
UniProt: Q16589 A0A024RDC7
LinkDB All DBs
Position
4q21.1
AA seq 344 aa AA seqDB search
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEIL
SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttgggggcagagcacttggcaggtcatgaaggggtccaacttctcgggttg
ttgaacgtctacctggaacaagaagagagattccaacctcgagaaaaagggctgagtttg
attgaggctaccccggagaatgataacactttgtgtccaggattgagaaatgccaaagtt
gaagatttaaggagtttagccaacttttttggatcttgcactgaaacttttgtcctggct
gtcaatattttggacaggttcttggctcttatgaaggtgaaacctaaacatttgtcttgc
attggagtctgttcttttttgctggctgctagaatagttgaagaagactgcaatattcca
tccactcatgatgtgatccggattagtcagtgtaaatgtactgcttctgacataaaacgg
atggaaaaaataatttcagaaaaattgcactatgaattggaagctactactgccttaaac
tttttgcacttataccatactattatactttgtcatacttcagaaaggaaagaaatactg
agccttgataaactagaagctcagctgaaagcttgcaactgccgactcatcttttcaaaa
gcaaaaccatctgtattagccttgtgccttctcaatttggaagtggaaactttgaaatct
gttgaattactggaaattctcttgctagttaaaaaacattccaagattaatgacactgag
ttcttctactggagagagttggtttctaaatgcctagccgagtattcttctcctgaatgt
tgcaaaccagatcttaagaagttggtttggatcgtttcaaggcgcacagcccagaacctc
cacaacagctactatagtgttcctgagctgccaacgatacctgaggggggttgttttgat
gaaagtgaaagtgaggactcttgtgaagatatgagttgtggagaggagagtctcagcagc
tctcctcccagtgatcaagagtgcaccttctttttcaacttcaaagtggcacaaacactg
tgctttccatcttag

DBGET integrated database retrieval system