KEGG   Homo sapiens (human): 90427Help
Entry
90427             CDS       T01001                                 

Gene name
BMF
Definition
(RefSeq) Bcl2 modifying factor
  KO
K17460  Bcl-2-modifying factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    90427 (BMF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BMF
Motif
Other DBs
NCBI-GeneID: 90427
NCBI-ProteinID: NP_001003940
OMIM: 606266
HGNC: 24132
Ensembl: ENSG00000104081
Vega: OTTHUMG00000129875
Pharos: Q96LC9(Tbio)
UniProt: Q96LC9
LinkDB All DBs
Position
15q15.1
AA seq 184 aa AA seqDB search
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
AGPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggagccatctcagtgtgtggaggagctggaggatgatgtgttccaaccagaggatggg
gagccggtgacccaacccgggagcttgctctctgctgacctgtttgcccagagcctactg
gactgccccctcagccgacttcagctcttccctctcacccactgctgtggccctggcctt
cgacccaccagccaggaagacaaagctacccagactctcagcccagcctcccccagccaa
ggtgtcatgctgccttgtggggtgactgaggaaccccagcgactcttttatggcaatgct
ggctatcggcttcctctccctgccagtttcccagcagtcttgcccattggggagcagccc
cccgaagggcagtggcaacatcaagcagaggtacagattgcccgaaagcttcagtgcatt
gcagaccagttccaccggcttcatgtgcagcaacaccagcagaaccaaaatcgtgtgtgg
tggcagatcctcctcttcctgcacaaccttgctttgaatggagaagagaacaggaacggg
gcaggccctaggtga

DBGET integrated database retrieval system