KEGG   Homo sapiens (human): 9047
Entry
9047              CDS       T01001                                 

Gene name
SH2D2A, F2771, SCAP, TSAD, VRAP
Definition
(RefSeq) SH2 domain containing 2A
  KO
K08273  SH2 domain-containing protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    9047 (SH2D2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9047 (SH2D2A)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   9047 (SH2D2A)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 9047
NCBI-ProteinID: NP_001154916
OMIM: 604514
HGNC: 10821
Ensembl: ENSG00000027869
Vega: OTTHUMG00000041305
Pharos: Q9NP31(Tbio)
UniProt: Q9NP31
LinkDB
Position
1q23.1
AA seq 389 aa
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVR
FSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGE
TLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS
QLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPP
AWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggagttccccctggcccagatatgtccccaagggagtcacgaagcccccatcccaacc
ttcagcaccttccagatcacagacatgacccgcaggagctgccagaacctgggctacact
gcggcatctccccaggccccggaggctgcctccaacacagggaatgctgagagggcagag
gaggtgcctggagaaggaagcctgttcctgcaggccgagacccgggcttggttccagaag
acccaggcccactggctcctgcagcacggggcagcccctgcctggttccatggcttcatc
acccggagggaggcagagaggctgctggagcccaagcctcaggggtgctacttggtgcgg
ttcagcgagagcgcggtgaccttcgtgctgacttacaggagccggacttgctgccgccac
ttcctgctggcccagctcagggacgggcgccacgtggtgctgggcgaggacagcgcccac
gcgcggctgcaggacctgctgctgcactacaccgcgcacccgctcagcccctacggggag
acgctcaccgagcccctcgcccgacagactcctgagcctgcaggactttccctgaggacc
gaagaatcaaactttggaagcaaaagccaggacccaaacccccagtacagcccaatcatc
aaacaggggcaagccccagtcccgatgcagaaagagggggccggggagaaggagccctcc
cagctgctcaggcccaagcctcccatccccgccaaacctcagctgcccccagaagtctac
acaatccctgttccacgacaccgcccggccccacgccccaagccctccaatcctatctac
aatgagcctgatgaacccatagctttctatgccatgggccggggcagccctggggaagcc
cccagcaacatctatgtggaagtggaagatgagggcctacccgccacccttgggcaccct
gtcctacggaagagctggtccaggcctgtcccaggaggccagaatacaggtggctcccag
ctgcattctgagaactctgtgattgggcaaggccctcccctgccccaccagcccccaccc
gcctggagacacaccctcccccacaatctttctagacaggtgcttcaggacagaggacag
gcatggcttccccttgggcctcctcagtag

DBGET integrated database retrieval system