KEGG   Homo sapiens (human): 90952Help
Entry
90952             CDS       T01001                                 

Gene name
ESAM, W117m
Definition
(RefSeq) endothelial cell adhesion molecule
  KO
K06787  endothelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    90952 (ESAM)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    90952 (ESAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig Ig_6 Receptor_2B4 TilS C2-set_2 DUF3042
Motif
Other DBs
NCBI-GeneID: 90952
NCBI-ProteinID: NP_620411
OMIM: 614281
HGNC: 17474
Ensembl: ENSG00000149564
Vega: OTTHUMG00000151986
Pharos: Q96AP7(Tbio)
UniProt: Q96AP7
LinkDB All DBs
Position
11q24.2
AA seq 390 aa AA seqDB search
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSK
PAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLE
VSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKS
SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISP
IPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctcccggggcccctggtgaccaacttgctgcggtttttgttcctggggctg
agtgccctcgcgcccccctcgcgggcccagctgcaactgcacttgcccgccaaccggttg
caggcggtggagggaggggaagtggtgcttccagcgtggtacaccttgcacggggaggtg
tcttcatcccagccatgggaggtgccctttgtgatgtggttcttcaaacagaaagaaaag
gaggatcaggtgttgtcctacatcaatggggtcacaacaagcaaacctggagtatccttg
gtctactccatgccctcccggaacctgtccctgcggctggagggtctccaggagaaagac
tctggcccctacagctgctccgtgaatgtgcaagacaaacaaggcaaatctaggggccac
agcatcaaaaccttagaactcaatgtactggttcctccagctcctccatcctgccgtctc
cagggtgtgccccatgtgggggcaaacgtgaccctgagctgccagtctccaaggagtaag
cccgctgtccaataccagtgggatcggcagcttccatccttccagactttctttgcacca
gcattagatgtcatccgtgggtctttaagcctcaccaacctttcgtcttccatggctgga
gtctatgtctgcaaggcccacaatgaggtgggcactgcccaatgtaatgtgacgctggaa
gtgagcacagggcctggagctgcagtggttgctggagctgttgtgggtaccctggttgga
ctggggttgctggctgggctggtcctcttgtaccaccgccggggcaaggccctggaggag
ccagccaatgatatcaaggaggatgccattgctccccggaccctgccctggcccaagagc
tcagacacaatctccaagaatgggaccctttcctctgtcacctccgcacgagccctccgg
ccaccccatggccctcccaggcctggtgcattgacccccacgcccagtctctccagccag
gccctgccctcaccaagactgcccacgacagatggggcccaccctcaaccaatatccccc
atccctggtggggtttcttcctctggcttgagccgcatgggtgctgtgcctgtgatggtg
cctgcccagagtcaagctggctctctggtatga

DBGET integrated database retrieval system