KEGG   Homo sapiens (human): 9101Help
Entry
9101              CDS       T01001                                 

Gene name
USP8, HumORF8, PITA4, SPG59, UBPY
Definition
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa04934  Cushing syndrome
Network
nt06312  EGFR-ERK-ACTH signaling
nt06360  Cushing syndrome
  Element
N00319  Mutation-activated USP8 to EGFR-ERK-ACTH signaling pathway
Disease
H01102  Pituitary adenomas
H01431  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9101 (USP8)
   04137 Mitophagy - animal
    9101 (USP8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    9101 (USP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    9101 (USP8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9101 (USP8)
   04121 Ubiquitin system [BR:hsa04121]
    9101 (USP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     9101 (USP8)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   9101 (USP8)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    9101 (USP8)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    9101 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH USP8_dimer UCH_1 Rhodanese Metallothio_Pro HscB_4_cys
Motif
Other DBs
NCBI-GeneID: 9101
NCBI-ProteinID: NP_001122082
OMIM: 603158
HGNC: 12631
Ensembl: ENSG00000138592
Vega: OTTHUMG00000131645
Pharos: P40818(Tbio)
UniProt: P40818 A0A024R5S4
LinkDB All DBs
Structure
PDB: 

Position
15q21.2
AA seq 1118 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDE
NIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSG
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctt
aataagaagacagaagttaaaccagagaaaataagcactaagagttatgtgcacagtgcc
ctgaagatctttaagacagcagaagaatgcagattagatcgtgatgaggaaagggcctat
gtactatatatgaaatacgtgactgtttataatcttatcaaaaaaagacctgatttcaag
caacagcaggattatttccattcaatacttggacctggaaacatcaaaaaagctgtcgaa
gaagctgaaagactctctgaaagccttaaattaagatatgaagaagctgaagtccggaaa
aaacttgaggaaaaagacaggcaggaggaagcacagcggctacaacaaaaaaggcaggaa
acaggaagagaggatggtggcacattggctaaaggctctttggagaatgttttggattcc
aaagacaaaacccaaaagagcaatggtgaaaagaatgaaaaatgtgagaccaaagagaaa
ggagcaatcacagcaaaggaactatacacaatgatgacggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaggattatcaggattcctgtattttacattctctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcacacctgcca
gatgattctaaagacacatggaagaagagggggaatgtggagtatgtggtacttcttgac
tggtttagttctgccaaagatttacagattggaacaactctccggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgcaatgagcctttggttttagagggaggc
tatgaaaactggctcctttgttatccccagtatacaacaaatgctaaggtcactccaccc
ccacgacgccagaatgaagaggtgtctatctcattggattttacttatccctcattggaa
gaatcaattccttctaaacctgctgcccagacgccacctgcatctatagaagtagatgaa
aatatagaattgataagtggtcaaaatgagagaatgggaccactgaatatatcaactcca
gttgaaccagttgctgcttctaaatctgatgtttcacccataattcagccagtgcctagt
ataaagaatgttccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagag
catagaataaaatctgaaagtacaaaccatgagcaacaatctcctcagagtggaaaagtt
attcctgatcgttccaccaagccagtagttttttctccaactctcatgttaacagatgaa
gaaaaggctcgtattcatgcagaaactgctcttctaatggaaaaaaacaaacaagaaaaa
gaacttcgggaaaggcagcaagaggaacagaaagagaaactgaggaaggaagaacaagaa
caaaaagccaaaaagaaacaagaagctgaagaaaatgaaattacagagaagcaacaaaaa
gcaaaagaagaaatggagaagaaagaaagtgaacaggccaagaaagaagataaagaaacc
tcagcaaagaggggcaaagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaa
acttctgatgccaagaaatctgtagaagatagggggaaaaggtgtccaaccccagaaata
cagaaaaagtcaacaggagatgtgccccatacatctgtgacaggggattcaggttcaggc
aagccatttaagattaaaggacaaccagaaagtggaattctaaggacaggaacttttaga
gaggatacagacgataccgaaagaaataaagctcaacgagaacctttgacaagagcacga
agtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaagtttcttgac
ccaatcactggaacctttcgttattatcattcacccaccaacactgttcatatgtaccca
ccggaaatggctccttcatctgcacctccttccacccctccaactcataaagccaagcca
cagattcctgctgagcgggatagggaaccttccaaactgaagcgctcctactcctcccca
gatataacccaggctattcaagaggaagagaagaggaagccaacagtaactccaacagtt
aatcgggaaaacaagccaacatgttatcctaaagctgagatctcaaggctttctgcttct
cagattcggaacctcaatcctgtttttggaggttctggaccagctcttactggacttcgt
aacttaggaaatacttgttatatgaactcaatattgcagtgcctatgtaacgctccacat
ttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaatttgttg
gggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtggacagga
cagtatagatatatcagtccaaaggactttaaaatcaccattgggaagatcaatgaccag
tttgcaggatacagtcagcaagattcacaagaattgcttctgttcctaatggatggtctc
catgaagatctaaataaagctgataatcggaagagatataaagaagaaaataatgatcat
ctcgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgagtct
attattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcacatgtcac
aaaaagtctaggacatttgaggccttcatgtatttgtctctaccactagcatccacaagt
aaatgtacattacaggattgccttagattattttccaaagaagaaaaactcacagataac
aacagattttactgcagtcattgcagagctcgacgggattctctaaaaaagatagaaatc
tggaagttaccacctgtgcttttagtgcatctgaaacgtttttcctacgatggcaggtgg
aaacaaaaattacagacatctgtggacttcccgttagaaaatcttgacttgtcacagtat
gttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactac
ggtgggctggatggaggccactacacagcctattgtaaaaatgcagcaagacaacggtgg
tttaagtttgatgatcatgaagtttctgatatctccgtttcttctgtgaaatcttcagca
gcttatatcctcttttatacttcattgggaccacgagtaactgatgtagccacataa

DBGET integrated database retrieval system