KEGG   Homo sapiens (human): 9119Help
Entry
9119              CDS       T01001                                 

Gene name
KRT75, K6HF, KB18, PFB
Definition
(RefSeq) keratin 75
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00672  Pseudofolliculitis barbae
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9119 (KRT75)
   04147 Exosome [BR:hsa04147]
    9119 (KRT75)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     9119 (KRT75)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   9119 (KRT75)
  Exosomal proteins of other body fluids (saliva and urine)
   9119 (KRT75)
  Exosomal proteins of colorectal cancer cells
   9119 (KRT75)
  Exosomal proteins of bladder cancer cells
   9119 (KRT75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 Spc7 Taxilin Jnk-SapK_ap_N ADIP KASH_CCD Ax_dynein_light DUF1664 APG6_N Golgin_A5 Tup_N FPP Baculo_PEP_C Tropomyosin_1 Lebercilin GAS T7SS_ESX_EspC UPF0242
Motif
Other DBs
NCBI-GeneID: 9119
NCBI-ProteinID: NP_004684
OMIM: 609025
HGNC: 24431
Ensembl: ENSG00000170454
Vega: OTTHUMG00000169592
Pharos: O95678(Tbio)
UniProt: O95678
LinkDB All DBs
Position
12q13.13
AA seq 551 aa AA seqDB search
MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSR
SLYNLGGAKRVSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGG
IQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETK
WALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE
DEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVG
DTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDL
RNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEAL
QKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLS
SGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVS
TTSSSQKSYTH
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggcagtcctccatcaccttccagtctggcagccgcaggggcttcagcaccacc
tcggccatcaccccggcagctggccgctcccgcttcagctctgtctctgtggcccgctct
gcagcagggagtgggggcctgggaaggatcagcagtgctggggccagctttggaagccgc
agcctctacaacctggggggtgccaagcgggtctccatcaatgggtgtggcagcagctgc
cgaagtggctttggtggcagggccagcaacaggtttggagtcaacagtggatttggctat
gggggtggagttggaggaggcttcagtggccccagcttccccgtgtgtccccctggaggc
atccaagaggtcactgtcaaccagagtctcctgactcctcttcacctgcaaatcgacccc
accatccagcgggtgcgggccgaggagcgcgagcagatcaagaccctcaacaataagttc
gcctccttcatcgacaaggtgaggttcttggagcagcagaacaaggtcctggagaccaag
tgggccctcctgcaggagcagggctccaggactgtgaggcagaacctagagcccctcttt
gattcctataccagtgagctccgacggcagctggaaagcatcaccaccgagaggggcagg
cttgaagctgaactgaggaacatgcaggatgttgtggaagatttcaaagtcaggtacgaa
gatgaaattaacaagcgcacagctgctgagaatgaatttgtagccctgaaaaaggacgta
gatgctgcctatatgaacaaggtggagctggaagccaaggtcaaatctctgcccgaggag
atcaacttcatccactcagtctttgatgcagagctgtcccagttgcagacccaggtcggt
gacacatccgtggtgctgtccatggacaacaaccgcaacctggacctggatagtatcatc
gccgaggtcaaagcacaatacgaggacattgccaaccgcagccgggccgaggctgagtcc
tggtaccagaccaagtacgaggagctgcaggtcaccgcaggcagacatggggatgacctt
cgaaacaccaaacaagagatctctgaaatgaaccgcatgatccagaggctgagagctgag
attgacagcgtcaagaagcagtgttccagcttgcaaacggccattgctgatgcagagcag
cggggagaactggctctcaaggatgcacgggccaagctggtggaccttgaggaggccctg
cagaaggccaagcaggacatggctcggctcctgcgtgagtaccaggagctgatgaacatc
aagctggccctggacgtggagatcgccacctaccgcaagctgctggaaggcgaggagtgc
aggttgagtggagagggagtttctccagttaacatttctgtggtcacctctactctttcc
agtggctatggaagcggcagcagcattggaggtggaaacctgggcctcggtgggggcagc
ggctactccttcaccaccagtggtgggcatagcctgggtgcaggcctgggaggttctgga
ttcagtgccaccagcaaccggggcttagggggcagtggttctagcgtcaagtttgtctcc
accacatcctccagccagaagagctacacgcactaa

DBGET integrated database retrieval system