KEGG   Homo sapiens (human): 9126Help
Entry
9126              CDS       T01001                                 

Gene name
SMC3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1
Definition
(RefSeq) structural maintenance of chromosomes 3
  KO
K06669  structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
Disease
H00631  Cornelia de Lange syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9126 (SMC3)
   04114 Oocyte meiosis
    9126 (SMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9126 (SMC3)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    9126 (SMC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    9126 (SMC3)
  Meiosis-specific sister chromatid cohesion proteins
    9126 (SMC3)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   9126 (SMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_23 AAA_29 Muted
Motif
Other DBs
NCBI-GeneID: 9126
NCBI-ProteinID: NP_005436
OMIM: 606062
HGNC: 2468
Ensembl: ENSG00000108055
Vega: OTTHUMG00000019042
Pharos: Q9UQE7(Tbio)
UniProt: Q9UQE7
LinkDB All DBs
Position
10q25.2
AA seq 1217 aa AA seqDB search
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLD
ELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK
QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEER
GIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDL
EDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQ
QALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNF
ECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAY
PETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSH
RGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQ
IETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAE
LGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRL
DQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKS
MERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTL
SLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNV
LELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERG
SGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFY
LFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDV
ITAEMAKDFVEDDTTHG
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgtacataaagcaggtgattatccagggttttcgaagttacagagatcaaacaattgta
gatcccttcagttcaaaacataatgtgattgtgggcagaaatggatctggaaaaagtaac
tttttttatgcaattcagtttgttctcagtgatgagtttagtcatcttcgtccagaacag
cggttggctttattgcatgaaggtactggtcctcgtgttatttctgcttttgtggagatt
atttttgataattcagacaaccggttaccaatcgataaagaggaagtttcacttcgaaga
gttattggtgccaaaaaggatcagtatttcttagacaagaagatggtcacgaaaaatgat
gtgatgaacctccttgaaagcgctggtttttctcgaagcaatccttattatattgttaaa
caaggaaagatcaaccagatggcaacagcaccagattctcagagattaaagctattaaga
gaagtagctggtactagagtgtatgacgaacgaaaggaagaaagcatctccttaatgaaa
gaaacagagggcaaacgggaaaaaatcaatgagttgttaaaatacattgaagagagatta
catactctagaggaagaaaaggaagaactagctcagtatcagaagtgggataaaatgaga
cgagccctggaatataccatttacaatcaggaacttaacgagactcgtgccaaacttgat
gagctttctgctaagcgagagactagtggagaaaaatccagacaattaagagatgctcag
caggatgcaagagataaaatggaggatatcgaacgccaagttagagaattgaaaacaaaa
atttcagctatgaaagaagaaaaagaacagcttagtgctgaaagacaagagcagattaag
cagaggactaagttggagcttaaagccaaggatttacaagatgaactagcaggcaatagt
gaacaaaggaaacgtttattaaaagagaggcagaagctgcttgaaaaaatagaagaaaag
cagaaagaactggcagaaacagaacccaaattcaacagtgtgaaagagaaagaagaacga
ggaattgctagattggctcaagctacccaggaaagaacggatctttatgcaaagcagggt
cgaggaagccagtttacatcaaaagaagaaagggataagtggattaaaaaggaactcaag
tctttagatcaggctattaatgacaagaaaagacagattgctgctatacataaggatttg
gaagacactgaagcaaataaagagaaaaatctggagcagtataataaactggaccaggat
cttaatgaagtcaaagctcgagtagaagaactggacagaaaatattacgaagtaaaaaat
aagaaagatgaactacaaagtgaaagaaactacttgtggagagaagagaatgcagaacag
caagcacttgctgctaaaagagaagatcttgaaaagaagcaacaacttcttagagcagca
acaggaaaggccattttaaatggaatagacagcataaacaaagtgctagaccacttccgt
cgaaaaggaataaaccagcatgttcaaaatggctatcatggtattgtaatgaataacttt
gaatgtgaaccagctttctacacatgcgtggaagtcactgctggaaacaggttattttat
cacattgttgattcagatgaagtcagcacgaagattttaatggagtttaataaaatgaat
cttcctggagaggttacttttctgcctcttaacaagttagatgtcagggatacagcctat
cctgaaaccaatgatgctattcctatgatcagcaaactgaggtacaatcccagatttgac
aaagctttcaaacatgtgtttggaaagactcttatttgtcgtagcatggaagtttcaacc
cagctggcccgtgctttcactatggactgtattactttggaaggtgaccaagtcagccat
cggggtgctctaactgggggttattatgacacaaggaagtctcgacttgaattgcaaaaa
gatgttagaaaagcagaagaagaactaggtgaacttgaagcaaagctcaatgaaaacctg
cgcagaaatattgaaaggattaataatgaaattgatcagttgatgaaccaaatgcaacag
atcgagacccagcaaaggaaatttaaagcatctagagatagcatattatcagaaatgaag
atgctaaaagagaagaggcagcagtcagagaaaaccttcatgcctaagcaacgtagctta
cagagtttggaggcaagcttgcatgctatggagtctaccagagagtcattgaaagcagaa
ctgggaactgatttgctttctcaactgagtttggaagatcagaagagagtagatgcactg
aatgatgagattcgtcaacttcagcaggaaaacagacagttgctaaatgaaagaattaaa
ttagaaggtattattactcgagtagagacttatctcaatgagaatctgagaaaacgcttg
gaccaagtagaacaggaacttaatgagctgagagagacagaagggggtactgttctcaca
gccacaacatcagaacttgaagccatcaataaaagagtaaaagacactatggcacgatca
gaagatttggacaattccattgataaaacagaagctggaattaaggagcttcagaagagt
atggagcgctggaaaaatatggaaaaagaacatatggatgctataaatcatgatactaaa
gaactggaaaagatgacaaatcggcaaggcatgctattgaagaagaaagaagagtgtatg
aagaaaattcgagaacttggatcacttccccaggaagcatttgaaaagtaccagacactg
agcctcaaacagttgtttcgaaaacttgagcagtgcaacacagaattaaagaagtacagc
catgttaacaaaaaggctttggatcagtttgtaaatttctccgagcagaaagaaaagtta
ataaagcgtcaagaagagttagataggggttacaaatcaatcatggaactgatgaatgta
cttgaacttcggaaatatgaagctattcagttaactttcaaacaggtatctaagaacttc
agtgaagtattccagaagttagtacctggtggcaaagctactttggtgatgaagaaagga
gatgtggagggcagtcagtctcaagatgaaggagaagggagtggtgagagtgagaggggt
tctggctcacaaagcagtgtcccatcagttgaccagtttactggagttggaattagggtg
tcatttacaggaaaacaaggtgaaatgagagaaatgcaacagctttcaggtggacagaaa
tccttggtagcccttgctctgatttttgccattcagaaatgtgacccggctccattttac
ttgtttgatgaaattgaccaggctctggatgctcagcacagaaaggctgtgtcagatatg
attatggaacttgctgtacatgctcagtttattacaactacttttaggcctgaactgctt
gagtcagctgacaaattctatggtgtaaagttcagaaataaggttagtcatattgatgtg
atcacagcagagatggccaaagactttgtagaagatgataccacacatggttaa

DBGET integrated database retrieval system