KEGG   Homo sapiens (human): 9134Help
Entry
9134              CDS       T01001                                 

Gene name
CCNE2, CYCE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06360  Cushing syndrome
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00360  HPV E7 to p27-cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
N00537  HBV HBx to cell cycle G1/S
Disease
H00055  Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    9134 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9134 (CCNE2)
   04114 Oocyte meiosis
    9134 (CCNE2)
   04115 p53 signaling pathway
    9134 (CCNE2)
   04218 Cellular senescence
    9134 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9134 (CCNE2)
   05206 MicroRNAs in cancer
    9134 (CCNE2)
   05203 Viral carcinogenesis
    9134 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    9134 (CCNE2)
   05215 Prostate cancer
    9134 (CCNE2)
   05222 Small cell lung cancer
    9134 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    9134 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9134 (CCNE2)
   05162 Measles
    9134 (CCNE2)
   05161 Hepatitis B
    9134 (CCNE2)
   05169 Epstein-Barr virus infection
    9134 (CCNE2)
   05165 Human papillomavirus infection
    9134 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    9134 (CCNE2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9134 (CCNE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    9134 (CCNE2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    9134 (CCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 9134
NCBI-ProteinID: NP_477097
OMIM: 603775
HGNC: 1590
Ensembl: ENSG00000175305
Vega: OTTHUMG00000164696
Pharos: O96020(Tbio)
UniProt: O96020 A0A024R9B0
LinkDB All DBs
Position
8q22.1
AA seq 404 aa AA seqDB search
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggaa
tccccccaagaagcccagataatccaggccaagaagaggaaaactacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctatgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaactatttggctatgctggaggaagtaaattacataaacaccttcagaaaaggggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system