KEGG   Homo sapiens (human): 9135Help
Entry
9135              CDS       T01001                                 

Gene name
RABEP1, RAB5EP, RABPT5
Definition
(RefSeq) rabaptin, RAB GTPase binding effector protein 1
  KO
K12480  Rab GTPase-binding effector protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9135 (RABEP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9135 (RABEP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    9135 (RABEP1)
 Protein recycling
   Rab4 associated proteins
    9135 (RABEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rabaptin Rab5-bind Fez1 Cep57_MT_bd Fib_succ_major
Motif
Other DBs
NCBI-GeneID: 9135
NCBI-ProteinID: NP_004694
OMIM: 603616
HGNC: 17677
Ensembl: ENSG00000029725
Vega: OTTHUMG00000177870
Pharos: Q15276(Tbio)
UniProt: Q15276
LinkDB All DBs
Structure
PDB: 

Position
17p13.2
AA seq 862 aa AA seqDB search
MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQ
NAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAV
MKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQED
AEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAV
LNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQR
MEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQ
LSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSK
ALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMT
PEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYE
KQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALV
LRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHV
SLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLK
ENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLE
EQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADS
LERIRAILNDTKLTDINQLPET
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccgggcccggcttcccagcctgacgtttctcttcagcaacgggtagcagaa
ttggaaaaaattaatgcagaatttttacgtgcacaacagcagcttgaacaagaatttaat
caaaagagagcaaaatttaaggagttatatttggctaaagaggaggatctgaagaggcaa
aatgcagtattacaagctgcacaagatgatttgggacaccttcgaacccagctgtgggaa
gctcaagcagagatggagaatattaaggcgattgccacagtctctgagaacaccaagcaa
gaagctatagatgaagtgaaaagacagtggagagaagaagttgcttcacttcaggctgtt
atgaaagaaacagttcgtgactatgagcaccagttccaccttaggctggagcaggagcga
acacagtgggcacagtatagagaatccgcagagagggaaatagctgatttaagaagaagg
ctgtctgaaggtcaagaggaggaaaatttagaaaatgaaatgaaaaaggcccaagaggat
gctgagaaacttcggtccgttgtgatgccaatggaaaaggaaattgcagctttgaaggat
aaactgacagaggctgaagacaaaattaaagagctggaggcctcaaaggttaaagaactg
aatcattatctggaagctgagaaatcttgtaggactgatctagagatgtatgtagctgtt
ttgaatactcagaaatctgttctacaggaagatgctgagaaactgcggaaagaattgcat
gaagtttgccatctcttggagcaagagcgacaacaacacaaccagttaaaacatacgtgg
cagaaggccaatgaccagtttctggaatctcagcgtttactgatgagagacatgcagcga
atggagattgtgctaacttcagaacagctccgacaagttgaagaactgaagaagaaagat
caggaggatgatgaacaacaaagactcaataagagaaaggatcacaaaaaagcagatgtt
gaggaagaaataaaaataccagtagtgtgtgctttaactcaagaagaatcttcagcccag
ttatcaaatgaagaggagcatttagacagcacccgtggctcagttcattccttagatgca
ggcttgctgttgccatctggagatcctttcagtaaatcggacaatgacatgtttaaagat
ggactcaggagagcacagtctacagacagcttgggaacctcgggctcattgcaatccaaa
gctttaggctataactacaaagcaaaatctgctggaaacctggacgagtcagattttgga
ccactggtaggagcagattcagtgtctgagaactttgatactgcatcccttgggtcactc
cagatgccaagtgggtttatgttaaccaaagatcaggaaagagcaatcaaggcgatgaca
ccagaacaagaagagacagcgtccctcctctccagcgttacccagggcatggagagtgcc
tatgtgtcccctagtggttatcgtttagttagtgaaacagaatggaatctcttgcagaaa
gaggtacataatgctggaaataaacttggtagacgttgtgatatgtgttccaattacgaa
aaacagttacaaggaattcagattcaggaggctgaaacgagagaccaggtgaaaaaacta
cagctgatgctaaggcaagctaatgaccagttagagaagacaatgaaagataagcaggag
ctggaagacttcataaagcaaagcagcgaagattcgagtcaccagatctctgcactcgtc
ctaagagcccaggcctccgagatcttacttgaagagttacagcaggggctttcccaggca
aagagggatgttcaggaacagatggcggtgctgatgcagtcacgggaacaggtttcagaa
gagctggtgaggttacagaaagataatgacagtctccagggaaagcacagcctgcatgtg
tcattacagcaagcagaagacttcatcctcccagacactacagaggcactgcgggagttg
gtattaaaataccgtgaggacatcattaatgtgcggacagcagcagaccacgtagaagaa
aagctgaaggctgagatacttttcctaaaagagcagatccaagcagaacagtgtttaaaa
gaaaatcttgaagaaactctgcaactagaaatagaaaactgcaaggaggaaatagcttct
atttctagcctaaaagctgaattagaaagaataaaagtggaaaaaggacagttggagtcc
acattaagagagaagtctcaacagcttgagagtcttcaggaaataaagatcagtttggaa
gagcagttaaagaaagagactgctgctaaggctaccgttgaacaactaatgtttgaagag
aagaataaagctcagagattacagacagaattagatgtcagtgagcaagtccagagggat
tttgtaaagctttcacagacccttcaggtgcagttagagcggatccggcaagctgactcc
ttggagagaatccgggcaattctgaatgatactaaactgacagacattaaccagcttcct
gagacatga

DBGET integrated database retrieval system