KEGG   Homo sapiens (human): 914Help
Entry
914               CDS       T01001                                 

Gene name
CD2, LFA-2, SRBC, T11
Definition
(RefSeq) CD2 molecule
  KO
K06449  T-cell surface glycoprotein CD2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04640  Hematopoietic cell lineage
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Siplizumab: D05847
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    914 (CD2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    914 (CD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    914 (CD2)
   04090 CD molecules [BR:hsa04090]
    914 (CD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   914 (CD2)
CD molecules [BR:hsa04090]
 Proteins
  914 (CD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set V-set Ig_2 I-set Shisa SARAF EphA2_TM LptF_LptG
Motif
Other DBs
NCBI-GeneID: 914
NCBI-ProteinID: NP_001758
OMIM: 186990
HGNC: 1639
Ensembl: ENSG00000116824
Vega: OTTHUMG00000022750
Pharos: P06729(Tclin)
UniProt: P06729 Q53F96
LinkDB All DBs
Structure
PDB: 

Position
1p13.1
AA seq 351 aa AA seqDB search
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccatgtaaatttgtagccagcttccttctgattttcaatgtttcttccaaa
ggtgcagtctccaaagagattacgaatgccttggaaacctggggtgccttgggtcaggac
atcaacttggacattcctagttttcaaatgagtgatgatattgacgatataaaatgggaa
aaaacttcagacaagaaaaagattgcacaattcagaaaagagaaagagactttcaaggaa
aaagatacatataagctatttaaaaatggaactctgaaaattaagcatctgaagaccgat
gatcaggatatctacaaggtatcaatatatgatacaaaaggaaaaaatgtgttggaaaaa
atatttgatttgaagattcaagagagggtctcaaaaccaaagatctcctggacttgtatc
aacacaaccctgacctgtgaggtaatgaatggaactgaccccgaattaaacctgtatcaa
gatgggaaacatctaaaactttctcagagggtcatcacacacaagtggaccaccagcctg
agtgcaaaattcaagtgcacagcagggaacaaagtcagcaaggaatccagtgtcgagcct
gtcagctgtccagagaaaggtctggacatctatctcatcattggcatatgtggaggaggc
agcctcttgatggtctttgtggcactgctcgttttctatatcaccaaaaggaaaaaacag
aggagtcggagaaatgatgaggagctggagacaagagcccacagagtagctactgaagaa
aggggccggaagccccaccaaattccagcttcaacccctcagaatccagcaacttcccaa
catcctcctccaccacctggtcatcgttcccaggcacctagtcatcgtcccccgcctcct
ggacaccgtgttcagcaccagcctcagaagaggcctcctgctccgtcgggcacacaagtt
caccagcagaaaggcccgcccctccccagacctcgagttcagccaaaacctccccatggg
gcagcagaaaactcattgtccccttcctctaattaa

DBGET integrated database retrieval system