KEGG   Homo sapiens (human): 915Help
Entry
915               CDS       T01001                                 

Gene name
CD3D, CD3-DELTA, IMD19, T3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Flotetuzumab: D11306
Muromonab-CD3: D05092
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    915 (CD3D)
   04660 T cell receptor signaling pathway
    915 (CD3D)
   04658 Th1 and Th2 cell differentiation
    915 (CD3D)
   04659 Th17 cell differentiation
    915 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    915 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    915 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    915 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    915 (CD3D)
   05162 Measles
    915 (CD3D)
   05169 Epstein-Barr virus infection
    915 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    915 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    915 (CD3D)
CD molecules [BR:hsa04090]
 Proteins
  915 (CD3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Motif
Other DBs
NCBI-GeneID: 915
NCBI-ProteinID: NP_000723
OMIM: 186790
HGNC: 1673
Ensembl: ENSG00000167286
Vega: OTTHUMG00000166970
Pharos: P04234(Tclin)
UniProt: P04234 B0YIY4
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 171 aa AA seqDB search
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacatagcacgtttctctctggcctggtactggctacccttctctcgcaagtgagc
cccttcaagatacctatagaggaacttgaggacagagtgtttgtgaattgcaataccagc
atcacatgggtagagggaacggtgggaacactgctctcagacattacaagactggacctg
ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatatatacaag
gacaaagaatctaccgtgcaagttcattatcgaatgtgccagagctgtgtggagctggat
ccagccaccgtggctggcatcattgtcactgatgtcattgccactctgctccttgctttg
ggagtcttctgctttgctggacatgagactggaaggctgtctggggctgccgacacacaa
gctctgttgaggaatgaccaggtctatcagcccctccgagatcgagatgatgctcagtac
agccaccttggaggaaactgggctcggaacaagtga

KEGG   Homo sapiens (human): 916Help
Entry
916               CDS       T01001                                 

Gene name
CD3E, IMD18, T3E, TCRE
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Cibisatamab: D11489
Duvortuxizumab: D11372
Flotetuzumab: D11306
Mosunetuzumab: D11463
Muromonab-CD3: D05092
Odronextamab: D11534
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    916 (CD3E)
   04660 T cell receptor signaling pathway
    916 (CD3E)
   04658 Th1 and Th2 cell differentiation
    916 (CD3E)
   04659 Th17 cell differentiation
    916 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    916 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    916 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    916 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    916 (CD3E)
   05162 Measles
    916 (CD3E)
   05169 Epstein-Barr virus infection
    916 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    916 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    916 (CD3E)
CD molecules [BR:hsa04090]
 Proteins
  916 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_3 Ig_2 P5-ATPase
Motif
Other DBs
NCBI-GeneID: 916
NCBI-ProteinID: NP_000724
OMIM: 186830
HGNC: 1674
Ensembl: ENSG00000198851
Vega: OTTHUMG00000166968
Pharos: P07766(Tclin)
UniProt: P07766
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 207 aa AA seqDB search
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgggcactcactggagagttctgggcctctgcctcttatcagttggcgtttgg
gggcaagatggtaatgaagaaatgggtggtattacacagacaccatataaagtctccatc
tctggaaccacagtaatattgacatgccctcagtatcctggatctgaaatactatggcaa
cacaatgataaaaacataggcggtgatgaggatgataaaaacataggcagtgatgaggat
cacctgtcactgaaggaattttcagaattggagcaaagtggttattatgtctgctacccc
agaggaagcaaaccagaagatgcgaacttttatctctacctgagggcaagagtgtgtgag
aactgcatggagatggatgtgatgtcggtggccacaattgtcatagtggacatctgcatc
actgggggcttgctgctgctggtttactactggagcaagaatagaaaggccaaggccaag
cctgtgacacgaggagcgggtgctggcggcaggcaaaggggacaaaacaaggagaggcca
ccacctgttcccaacccagactatgagcccatccggaaaggccagcgggacctgtattct
ggcctgaatcagagacgcatctga

KEGG   Homo sapiens (human): 917Help
Entry
917               CDS       T01001                                 

Gene name
CD3G, CD3-GAMMA, IMD17, T3G
Definition
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Disease
H00093  Combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Flotetuzumab: D11306
Muromonab-CD3: D05092
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    917 (CD3G)
   04660 T cell receptor signaling pathway
    917 (CD3G)
   04658 Th1 and Th2 cell differentiation
    917 (CD3G)
   04659 Th17 cell differentiation
    917 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    917 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    917 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    917 (CD3G)
   05162 Measles
    917 (CD3G)
   05169 Epstein-Barr virus infection
    917 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    917 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    917 (CD3G)
CD molecules [BR:hsa04090]
 Proteins
  917 (CD3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_2 Ig_3
Motif
Other DBs
NCBI-GeneID: 917
NCBI-ProteinID: NP_000064
OMIM: 186740
HGNC: 1675
Ensembl: ENSG00000160654
Vega: OTTHUMG00000166971
Pharos: P09693(Tclin)
UniProt: P09693 B0YIY5
LinkDB All DBs
Position
11q23.3
AA seq 182 aa AA seqDB search
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggggaagggcctggctgtcctcatcctggctatcattcttcttcaaggtact
ttggcccagtcaatcaaaggaaaccacttggttaaggtgtatgactatcaagaagatggt
tcggtacttctgacttgtgatgcagaagccaaaaatatcacatggtttaaagatgggaag
atgatcggcttcctaactgaagataaaaaaaaatggaatctgggaagtaatgccaaggac
cctcgagggatgtatcagtgtaaaggatcacagaacaagtcaaaaccactccaagtgtat
tacagaatgtgtcagaactgcattgaactaaatgcagccaccatatctggctttctcttt
gctgaaatcgtcagcattttcgtccttgctgttggggtctacttcattgctggacaggat
ggagttcgccagtcgagagcttcagacaagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgagaagatgaccagtacagccaccttcaaggaaaccagttgagg
aggaattga

KEGG   Homo sapiens (human): 919Help
Entry
919               CDS       T01001                                 

Gene name
CD247, CD3-ZETA, CD3H, CD3Q, CD3Z, IMD25, T3Z, TCRZ
Definition
(RefSeq) CD247 molecule
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Disease
H00091  T-B+Severe combined immunodeficiency
H01492  Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    919 (CD247)
   04660 T cell receptor signaling pathway
    919 (CD247)
   04658 Th1 and Th2 cell differentiation
    919 (CD247)
   04659 Th17 cell differentiation
    919 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    919 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    919 (CD247)
   05169 Epstein-Barr virus infection
    919 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    919 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    919 (CD247)
   04090 CD molecules [BR:hsa04090]
    919 (CD247)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   919 (CD247)
CD molecules [BR:hsa04090]
 Proteins
  919 (CD247)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ITAM TCR_zetazeta
Motif
Other DBs
NCBI-GeneID: 919
NCBI-ProteinID: NP_932170
OMIM: 186780
HGNC: 1677
Ensembl: ENSG00000198821
Vega: OTTHUMG00000034593
Pharos: P20963(Tbio)
UniProt: P20963
LinkDB All DBs
Structure
PDB: 

Position
1q24.2
AA seq 164 aa AA seqDB search
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaaggcgcttttcaccgcggccatcctgcaggcacagttgccgattacagag
gcacagagctttggcctgctggatcccaaactctgctacctgctggatggaatcctcttc
atctatggtgtcattctcactgccttgttcctgagagtgaagttcagcaggagcgcagac
gcccccgcgtaccagcagggccagaaccagctctataacgagctcaatctaggacgaaga
gaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccg
cagagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcg
gaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggc
ctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggcc
ctgccccctcgctaa

DBGET integrated database retrieval system