KEGG   Homo sapiens (human): 91543
Entry
91543             CDS       T01001                                 

Gene name
RSAD2, 2510004L01Rik, cig33, cig5, vig1
Definition
(RefSeq) radical S-adenosyl methionine domain containing 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    91543 (RSAD2)
   05164 Influenza A
    91543 (RSAD2)
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 91543
NCBI-ProteinID: NP_542388
OMIM: 607810
HGNC: 30908
Ensembl: ENSG00000134321
Vega: OTTHUMG00000090352
Pharos: Q8WXG1(Tbio)
UniProt: Q8WXG1
LinkDB
Position
2p25.2
AA seq 361 aa
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI
NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC
DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL
NPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD
W
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtgggtgcttacacctgctgcttttgctgggaagctcttgagtgtgttcaggcaacct
ctgagctctctgtggaggagcctggtcccgctgttctgctggctgagggcaaccttctgg
ctgctagctaccaagaggagaaagcagcagctggtcctgagagggccagatgagaccaaa
gaggaggaagaggaccctcctctgcccaccaccccaaccagcgtcaactatcacttcact
cgccagtgcaactacaaatgcggcttctgtttccacacagccaaaacatcctttgtgctg
ccccttgaggaagcaaagagaggattgcttttgcttaaggaagctggtatggagaagatc
aacttttcaggtggagagccatttcttcaagaccggggagaatacctgggcaagttggtg
aggttctgcaaagtagagttgcggctgcccagcgtgagcatcgtgagcaatggaagcctg
atccgggagaggtggttccagaattatggtgagtatttggacattctcgctatctcctgt
gacagctttgacgaggaagtcaatgtccttattggccgtggccaaggaaagaagaaccat
gtggaaaaccttcaaaagctgaggaggtggtgtagggattatagagtcgctttcaagata
aattctgtcattaatcgtttcaacgtggaagaggacatgacggaacagatcaaagcacta
aaccctgtccgctggaaagtgttccagtgcctcttaattgagggtgagaattgtggagaa
gatgctctaagagaagcagaaagatttgttattggtgatgaagaatttgaaagattcttg
gagcgccacaaagaagtgtcctgcttggtgcctgaatctaaccagaagatgaaagactcc
taccttattctggatgaatatatgcgctttctgaactgtagaaagggacggaaggaccct
tccaagtccatcctggatgttggtgtagaagaagctataaaattcagtggatttgatgaa
aagatgtttctgaagcgaggaggaaaatacatatggagtaaggctgatctgaagctggat
tggtag

DBGET integrated database retrieval system