KEGG   Homo sapiens (human): 9166
Entry
9166              CDS       T01001                                 

Gene name
EBAG9, EB9, PDAF
Definition
(RefSeq) estrogen receptor binding site associated antigen 9
  KO
K22455  estrogen receptor-binding fragment-associated gene 9 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Network
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    9166 (EBAG9)
SSDB
Other DBs
NCBI-GeneID: 9166
NCBI-ProteinID: NP_001265867
OMIM: 605772
HGNC: 3123
Ensembl: ENSG00000147654
Vega: OTTHUMG00000165346
Pharos: O00559(Tbio)
UniProt: O00559 A0A024R9E0
LinkDB
Position
8q23.2
AA seq 213 aa
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
PDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLAD
REKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggccatcacccagtttcggttatttaaattttgtacctgcctagcaacagtattctca
ttcctaaagagattaatatgcagatctggcagaggacggaaattaagtggagaccaaata
actttgccaactacagttgattattcatcagttcctaagcagacagatgttgaagagtgg
acttcctgggatgaagatgcacccaccagtgtaaagatcgaaggagggaatgggaatgtg
gcaacacaacaaaattctttggaacaactggaacctgactattttaaggacatgacacca
actattaggaaaactcagaaaattgttattaagaagagagaaccattgaattttggcatc
ccagatgggagcacaggtttctctagtagattagcagctacacaagatctgccttttatt
catcagtcttctgaattaggtgacttagatacctggcaggaaaataccaatgcatgggaa
gaagaagaagatgcagcctggcaagcagaagaagttctgagacagcagaaactagcagac
agagaaaagagagcagccgaacaacaaaggaagaaaatggaaaaggaagcacaacggcta
atgaagaaggaacaaaacaaaattggtgtgaaactttcataa

DBGET integrated database retrieval system