KEGG   Homo sapiens (human): 917Help
Entry
917               CDS       T01001                                 

Gene name
CD3G, CD3-GAMMA, IMD17, T3G
Definition
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Disease
H00093  Combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Flotetuzumab: D11306
Muromonab-CD3: D05092
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    917 (CD3G)
   04660 T cell receptor signaling pathway
    917 (CD3G)
   04658 Th1 and Th2 cell differentiation
    917 (CD3G)
   04659 Th17 cell differentiation
    917 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    917 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    917 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    917 (CD3G)
   05162 Measles
    917 (CD3G)
   05169 Epstein-Barr virus infection
    917 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    917 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    917 (CD3G)
CD molecules [BR:hsa04090]
 Proteins
  917 (CD3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_2 Ig_3
Motif
Other DBs
NCBI-GeneID: 917
NCBI-ProteinID: NP_000064
OMIM: 186740
HGNC: 1675
Ensembl: ENSG00000160654
Vega: OTTHUMG00000166971
Pharos: P09693(Tclin)
UniProt: P09693 B0YIY5
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 182 aa AA seqDB search
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggggaagggcctggctgtcctcatcctggctatcattcttcttcaaggtact
ttggcccagtcaatcaaaggaaaccacttggttaaggtgtatgactatcaagaagatggt
tcggtacttctgacttgtgatgcagaagccaaaaatatcacatggtttaaagatgggaag
atgatcggcttcctaactgaagataaaaaaaaatggaatctgggaagtaatgccaaggac
cctcgagggatgtatcagtgtaaaggatcacagaacaagtcaaaaccactccaagtgtat
tacagaatgtgtcagaactgcattgaactaaatgcagccaccatatctggctttctcttt
gctgaaatcgtcagcattttcgtccttgctgttggggtctacttcattgctggacaggat
ggagttcgccagtcgagagcttcagacaagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgagaagatgaccagtacagccaccttcaaggaaaccagttgagg
aggaattga

DBGET integrated database retrieval system