KEGG   Homo sapiens (human): 9184Help
Entry
9184              CDS       T01001                                 

Gene name
BUB3, BUB3L, hBUB3
Definition
(RefSeq) BUB3 mitotic checkpoint protein
  KO
K02180  cell cycle arrest protein BUB3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9184 (BUB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9184 (BUB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9184 (BUB3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9184 (BUB3)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    9184 (BUB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     9184 (BUB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 9184
NCBI-ProteinID: NP_004716
OMIM: 603719
HGNC: 1151
Ensembl: ENSG00000154473
Vega: OTTHUMG00000019197
Pharos: O43684(Tbio)
UniProt: O43684
LinkDB All DBs
Position
10q26.13
AA seq 328 aa AA seqDB search
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKSPCT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctaacgagttcaagctgaaccagccacccgaggatggcatctcctccgtg
aagttcagccccaacacctcccagttcctgcttgtctcctcctgggacacgtccgtgcgt
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacaccggcgccgtcctg
gactgcgccttctacgatccaacgcatgcctggagtggaggactagatcatcaattgaaa
atgcatgatttgaacactgatcaagaaaatcttgttgggacccatgatgcccctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggtcactggaagttgggatcagacagtt
aaactgtgggatcccagaactccttgtaatgctgggaccttctctcagcctgaaaaggta
tataccctctcagtgtctggagaccggctgattgtgggaacagcaggccgcagagtgttg
gtgtgggacttacggaacatgggttacgtgcagcagcgcagggagtccagcctgaaatac
cagactcgctgcatacgagcgtttccaaacaagcagggttatgtattaagctctattgaa
ggccgagtggcagttgagtatttggacccaagccctgaggtacagaagaagaagtatgcc
ttcaaatgtcacagactaaaagaaaataatattgagcagatttacccagtcaatgccatt
tcttttcacaatatccacaatacatttgccacaggtggttctgatggctttgtaaatatt
tgggatccatttaacaaaaagcgactgtgccaattccatcggtaccccacgagcatcgca
tcacttgccttcagtaatgatgggactacgcttgcaatagcgtcatcatatatgtatgaa
atggatgacacagaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtcaccatgtacttga

DBGET integrated database retrieval system