KEGG   Homo sapiens (human): 91862
Entry
91862             CDS       T01001                                 

Gene name
MARVELD3, MARVD3, MRVLDC3
Definition
(RefSeq) MARVEL domain containing 3
  KO
K21099  MARVEL domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    91862 (MARVELD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    91862 (MARVELD3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   91862 (MARVELD3)
SSDB
Motif
Pfam: MARVEL DUF3185 DUF2371
Other DBs
NCBI-GeneID: 91862
NCBI-ProteinID: NP_443090
OMIM: 614094
HGNC: 30525
Ensembl: ENSG00000140832
Vega: OTTHUMG00000137591
Pharos: Q96A59(Tbio)
UniProt: Q96A59
LinkDB
Position
16q22.2
AA seq 401 aa
MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPE
RDQERDGNRDRNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGAR
GLTWDAAAPPGPAPWEAPEPPQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQS
EAEGLLECHKCKYLCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQF
GGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGALTALCCLFVAMGVLRVPWHCP
LLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYSGFGCSFHGAD
IGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggaagatccgtcgggggctcgcgagccccgggcccggccgagagagcgggacccggga
cggcgcccccacccagaccaaggccgcacccacgatcgaccgcgggaccgacccggggac
ccgcgcaggaagcgaagcagcgacgggaaccggcgaagggacggggaccgggacccggag
agagaccaggagagggacgggaaccgcgaccggaaccgggaccgggagagggagagagag
agggaaagagacccggaccgaggcccccgccgggacacacacagggacgcgggccctcgc
gcaggtgaacacggagtttgggaaaaaccgcgccaaagccggacgcgggacggagcccgg
ggactgacctgggacgcagccgcgcctcctgggcccgcgccctgggaagccccggagccg
ccgcagccgcagaggaagggagaccccgggcgccgcagacccgaaagtgaacccccttcg
gagagatatctgccctcgacccccaggcctggacgagaggaggtggaatattaccagtca
gaggcggaaggactcctggaatgccacaaatgcaaatacttgtgcactgggagagcctgc
tgccaaatgctggaggttctcctgaacttgctgatcctggcctgcagctctgtgtcttac
agttccacagggggctacacgggcatcaccagcttggggggcatttactactatcagttc
ggaggggcttacagtggctttgatggtgctgacggggagaaggcccagcaactggatgtc
cagttctaccagctaaagctgcccatggtcactgtggcaatggcctgtagtggagccctc
acagccctctgctgcctcttcgttgccatgggtgtcctgcgggtcccgtggcattgtcca
ctgttgctggtgaccgaaggcttgttggacatgctcatcgcgggggggtacatcccggcc
ttgtacttctacttccactacctctctgctgcctatggctctcctgtgtgtaaagagagg
caggcgctgtaccaaagcaaaggctacagcggtttcggctgcagtttccacggagcagat
ataggagctggaatctttgctgccctgggcattgtggtctttgccctgggggctgtcctg
gccataaagggctaccgaaaagttaggaagctaaaagagaagccagcagaaatgtttgaa
ttttaa

DBGET integrated database retrieval system