KEGG   Homo sapiens (human): 919Help
Entry
919               CDS       T01001                                 

Gene name
CD247, CD3-ZETA, CD3H, CD3Q, CD3Z, IMD25, T3Z, TCRZ
Definition
(RefSeq) CD247 molecule
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Disease
H00091  T-B+Severe combined immunodeficiency
H01492  Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    919 (CD247)
   04660 T cell receptor signaling pathway
    919 (CD247)
   04658 Th1 and Th2 cell differentiation
    919 (CD247)
   04659 Th17 cell differentiation
    919 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    919 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    919 (CD247)
   05169 Epstein-Barr virus infection
    919 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    919 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    919 (CD247)
   04090 CD molecules [BR:hsa04090]
    919 (CD247)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   919 (CD247)
CD molecules [BR:hsa04090]
 Proteins
  919 (CD247)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ITAM TCR_zetazeta
Motif
Other DBs
NCBI-GeneID: 919
NCBI-ProteinID: NP_932170
OMIM: 186780
HGNC: 1677
Ensembl: ENSG00000198821
Vega: OTTHUMG00000034593
Pharos: P20963(Tbio)
UniProt: P20963
LinkDB All DBs
Structure
PDB: 

Position
1q24.2
AA seq 164 aa AA seqDB search
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaaggcgcttttcaccgcggccatcctgcaggcacagttgccgattacagag
gcacagagctttggcctgctggatcccaaactctgctacctgctggatggaatcctcttc
atctatggtgtcattctcactgccttgttcctgagagtgaagttcagcaggagcgcagac
gcccccgcgtaccagcagggccagaaccagctctataacgagctcaatctaggacgaaga
gaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccg
cagagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcg
gaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggc
ctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggcc
ctgccccctcgctaa

DBGET integrated database retrieval system