KEGG   Homo sapiens (human): 920Help
Entry
920               CDS       T01001                                 

Gene name
CD4, CD4mut
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Cedelizumab: D03420
Ibalizumab: D09575
Priliximab: D05610
Zanolimumab: D06356
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    920 (CD4)
   04514 Cell adhesion molecules (CAMs)
    920 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    920 (CD4)
   04612 Antigen processing and presentation
    920 (CD4)
   04660 T cell receptor signaling pathway
    920 (CD4)
   04658 Th1 and Th2 cell differentiation
    920 (CD4)
   04659 Th17 cell differentiation
    920 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    920 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    920 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    920 (CD4)
   05170 Human immunodeficiency virus 1 infection
    920 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    920 (CD4)
CD molecules [BR:hsa04090]
 Proteins
  920 (CD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD4-extracel C2-set ig Tcell_CD4_C V-set I-set Ig_3 Ig_2 Receptor_2B4 Ig_5 Ig_6 Herpes_gE
Motif
Other DBs
NCBI-GeneID: 920
NCBI-ProteinID: NP_000607
OMIM: 186940
HGNC: 1678
Ensembl: ENSG00000010610
Vega: OTTHUMG00000168514
Pharos: P01730(Tchem)
UniProt: P01730 B4DT49
LinkDB All DBs
Structure
PDB: 

Position
12p13.31
AA seq 458 aa AA seqDB search
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggggagtcccttttaggcacttgcttctggtgctgcaactggcgctcctccca
gcagccactcagggaaagaaagtggtgctgggcaaaaaaggggatacagtggaactgacc
tgtacagcttcccagaagaagagcatacaattccactggaaaaactccaaccagataaag
attctgggaaatcagggctccttcttaactaaaggtccatccaagctgaatgatcgcgct
gactcaagaagaagcctttgggaccaaggaaactttcccctgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtggaggaccagaaggaggaggtgcaattg
ctagtgttcggattgactgccaactctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgcaatgtaggagtccaaggggt
aaaaacatacagggggggaagaccctctccgtgtctcagctggagctccaggatagtggc
acctggacatgcactgtcttgcagaaccagaagaaggtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcatagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacagttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcttcctcctccaagtcttggatcacctttgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccctaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcaccctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctggtggtgatgagagccact
cagctccagaaaaatttgacctgtgaggtgtggggacccacctcccctaagctgatgctg
agtttgaaactggagaacaaggaggcaaaggtctcgaagcgggagaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgctg
gaatccaacatcaaggttctgcccacatggtccaccccggtgcagccaatggccctgatt
gtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttctgtgtc
aggtgccggcaccgaaggcgccaagcagagcggatgtctcagatcaagagactcctcagt
gagaagaagacctgccagtgtcctcaccggtttcagaagacatgtagccccatttga

KEGG   Homo sapiens (human): 925Help
Entry
925               CDS       T01001                                 

Gene name
CD8A, CD8, Leu2, p32
Definition
(RefSeq) CD8a molecule
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    925 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    925 (CD8A)
   04612 Antigen processing and presentation
    925 (CD8A)
   04660 T cell receptor signaling pathway
    925 (CD8A)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    925 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    925 (CD8A)
CD molecules [BR:hsa04090]
 Proteins
  925 (CD8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 925
NCBI-ProteinID: NP_001139345
OMIM: 186910
HGNC: 1706
Ensembl: ENSG00000153563
Vega: OTTHUMG00000130265
Pharos: P01732(Tbio)
UniProt: P01732 Q6ZVS2 Q8TAW8
LinkDB All DBs
Structure
PDB: 

Position
2p11.2
AA seq 235 aa AA seqDB search
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccagg
ccgagccagttccgggtgtcgccgctggatcggacctggaacctgggcgagacagtggag
ctgaagtgccaggtgctgctgtccaacccgacgtcgggctgctcgtggctcttccagccg
cgcggcgccgccgccagtcccaccttcctcctatacctctcccaaaacaagcccaaggcg
gccgaggggctggacacccagcggttctcgggcaagaggttgggggacaccttcgtcctc
accctgagcgacttccgccgagagaacgagggctactatttctgctcggccctgagcaac
tccatcatgtacttcagccacttcgtgccggtcttcctgccagcgaagcccaccacgacg
ccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgc
ccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcc
tgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactg
gttatcaccctttactgcaaccacaggaaccgaagacgtgtttgcaaatgtccccggcct
gtggtcaaatcgggagacaagcccagcctttcggcgagatacgtctaa

KEGG   Homo sapiens (human): 926Help
Entry
926               CDS       T01001                                 

Gene name
CD8B, CD8B1, LEU2, LY3, LYT3, P37
Definition
(RefSeq) CD8b molecule
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    926 (CD8B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    926 (CD8B)
   04612 Antigen processing and presentation
    926 (CD8B)
   04660 T cell receptor signaling pathway
    926 (CD8B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    926 (CD8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    926 (CD8B)
CD molecules [BR:hsa04090]
 Proteins
  926 (CD8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 Herpes_gE Ig_6
Motif
Other DBs
NCBI-GeneID: 926
NCBI-ProteinID: NP_004922
OMIM: 186730
HGNC: 1707
Ensembl: ENSG00000172116
Vega: OTTHUMG00000130264
Pharos: P10966(Tbio)
UniProt: P10966
LinkDB All DBs
Position
2p11.2
AA seq 210 aa AA seqDB search
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactca
gtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcc
tgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggca
ccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatc
cacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcatt
ctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcggg
agccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccacc
actgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggcca
gagacccagaagggcccactttgtagccccatcacccttggcctgctggtggctggcgtc
ctggttctgctggtttccctgggagtggccatccacctgtgctgccggcggaggagagcc
cggcttcgtttcatgaaacaattttacaaatga

DBGET integrated database retrieval system