KEGG   Homo sapiens (human): 921Help
Entry
921               CDS       T01001                                 

Gene name
CD5, LEU1, T1
Definition
(RefSeq) CD5 molecule
  KO
K06455  T-cell surface glycoprotein CD5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Zolimomab aritox: D06381
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    921 (CD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    921 (CD5)
CD molecules [BR:hsa04090]
 Proteins
  921 (CD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR Comm
Motif
Other DBs
NCBI-GeneID: 921
NCBI-ProteinID: NP_055022
OMIM: 153340
HGNC: 1685
Ensembl: ENSG00000110448
Vega: OTTHUMG00000167825
Pharos: P06127(Tbio)
UniProt: P06127
LinkDB All DBs
Structure
PDB: 

Position
11q12.2
AA seq 495 aa AA seqDB search
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC
SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC
KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD
NSSDSDYDLHGAQRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcccatggggtctctgcaaccgctggccaccttgtacctgctggggatgctggtcgct
tcctgcctcggacggctcagctggtatgacccagatttccaggcaaggctcacccgttcc
aactcgaagtgccagggccagctggaggtctacctcaaggacggatggcacatggtttgc
agccagagctggggccggagctccaagcagtgggaggaccccagtcaagcgtcaaaagtc
tgccagcggctgaactgtggggtgcccttaagccttggccccttccttgtcacctacaca
cctcagagctcaatcatctgctacggacaactgggctccttctccaactgcagccacagc
agaaatgacatgtgtcactctctgggcctgacctgcttagaaccccagaagacaacacct
ccaacgacaaggcccccgcccaccacaactccagagcccacagctcctcccaggctgcag
ctggtggcacagtctggcggccagcactgtgccggcgtggtggagttctacagcggcagc
ctggggggtaccatcagctatgaggcccaggacaagacccaggacctggagaacttcctc
tgcaacaacctccagtgtggctccttcttgaagcatctgccagagactgaggcaggcaga
gcccaagacccaggggagccacgggaacaccagcccttgccaatccaatggaagatccag
aactcaagctgtacctccctggagcattgcttcaggaaaatcaagccccagaaaagtggc
cgagttcttgccctcctttgctcaggtttccagcccaaggtgcagagccgtctggtgggg
ggcagcagcatctgtgaaggcaccgtggaggtgcgccagggggctcagtgggcagccctg
tgtgacagctcttcagccaggagctcgctgcggtgggaggaggtgtgccgggagcagcag
tgtggcagcgtcaactcctatcgagtgctggacgctggtgacccaacatcccgggggctc
ttctgtccccatcagaagctgtcccagtgccacgaactttgggagagaaattcctactgc
aagaaggtgtttgtcacatgccaggatccaaaccccgcaggcctggccgcaggcacggtg
gcaagcatcatcctggccctggtgctcctggtggtgctgctggtcgtgtgcggccccctt
gcctacaagaagctagtgaagaaattccgccagaagaagcagcgccagtggattggccca
acgggaatgaaccaaaacatgtctttccatcgcaaccacacggcaaccgtccgatcccat
gctgagaaccccacagcctcccacgtggataacgaatacagccaacctcccaggaactcc
cacctgtcagcttatccagctctggaaggggctctgcatcgctcctccatgcagcctgac
aactcctccgacagtgactatgatctgcatggggctcagaggctgtaa

DBGET integrated database retrieval system