KEGG   Homo sapiens (human): 9229
Entry
9229              CDS       T01001                                 

Gene name
DLGAP1, DAP-1, DAP-1-ALPHA, DAP-1-BETA, DAP1, DLGAP1A, DLGAP1B, GKAP, SAPAP1
Definition
(RefSeq) DLG associated protein 1
  KO
K15008  discs, large-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9229 (DLGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9229 (DLGAP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    9229 (DLGAP1)
SSDB
Motif
Pfam: GKAP
Other DBs
NCBI-GeneID: 9229
NCBI-ProteinID: NP_004737
OMIM: 605445
HGNC: 2905
Ensembl: ENSG00000170579
Vega: OTTHUMG00000131537
Pharos: O14490(Tbio)
UniProt: O14490
LinkDB
Position
18p11.31
AA seq 977 aa
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGP
FSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHT
LQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAY
NTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWSSTLTVSRAREVYQKASVNMD
QAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALD
LPMPGCFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKK
TPPPVPPRTTTKPFISITAQSSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALT
AAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAE
EPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDN
SCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDP
LEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWK
QMDPLDKKERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSAT
ESAESIEIYIPEAQTRL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaaagggctatcaggcagccgcagccatcaccacggggtcacctgcgactcggcctgt
gactcgctgtcgcaccactccgaccgcaagccctacctgctgagcccagtggagcaccac
cccgcagaccacccatactacacccagcggaactccttccaggctgagtgcgtgggcccc
ttcagcgacccgctggccagcagcaccttcccccgcaggcactacacctcgcagcaagag
ctgaaggacgagtgtgccctggtgccccgcaccctggccaccaaggcgaaccgcatcccc
gccaacctgctggaccagttcgagcggcagctgccactcagccgcgatggctatcacacc
ctgcagtacaagcgcacggccgtggagcaccgcagcgacagccccggccgcatccgccac
ctggtgcactcggtccagaagctcttcaccaagtcgcactccctggaggggccgtccaag
ggcagcgtcaacgggggcaaggccagccctgacgaggcgcaggcggcgcgctatggcaaa
cgcagcaagagcaaggagcggcgcgcggagcccaaggcccggcccagcacctccccgggc
tggtggagctcggacgacaacctggatggtgacatgtgcatctaccacgccccctcgggc
gtgatgaccatgggcaggtgccccgaccgctcggcctcacagtacttcctggaggcctac
aacaccatcagcgagcaggcggtgaaggcctcccggagcaacaacgacgtcaagtgctcc
acctgcgccaacctgccggtcagcctggacaccccgctgctgaagaagagcgcctggtcc
tccacgctcaccgtgagccgggcccgggaggtttaccagaaggcctcggtgaacatggac
caggccatggtgaagtccgagtcgtgtcagcaagaacgctcctgccagtacctgcaggtt
ccacaagatgaatggacagggtacaccccacgaggtaaagatgatgaaattccatgccga
agaatgcggagtggcagttatatcaaggccatgggggatgaagacagtggagactcagac
acgagtcctaagccttctccaaaagttgctgcgcggagagaaagctatctcaaggctact
cagccatcccttacagaactcaccacactcaaaatctccaatgaacactcacccaaactc
cagatccggagtcatagttacctgagggcagtgagtgaagtctccatcaaccggagcctg
gacagcctggaccctgcaggcttgctcacatcaccaaagttccgctccaggaatgagagc
tacatgcgagccatgagcaccatcagccaggtgagcgagatggaagtgaacgggcagttc
gagtccgtgtgcgagtccgtgttcagcgagctggagtcgcaggccgtggaagcgctggac
ctgcccatgcccggctgcttccgcatgcggagccacagctatgtgcgggccattgagaaa
ggctgctcccaggacgacgagtgcgtgtccctgaggtcgtcctcgccgccgcgcaccacc
accaccgttaggaccatccagagcagcacggtgtcatcttgcattacaacatataagaag
acaccacctccagtcccacccagaactaccacgaaacctttcatttctatcacagcccag
agtagcacagagtcagcccaggatgcctacatggacggacagggccagcgaggagatatt
atcagccagtctggactcagcaactccaccgagagcctggacagtatgaaggctctgaca
gccgccatcgaagctgcaaacgcccagatccatggccctgccagtcaacacatgggcaat
aacactgccaccgtcaccaccacgactaccatagccaccgtcaccacggaggacaggaag
aaggaccactttaagaaaaatcgatgcctgtctatcgggatacaggtggatgatgctgaa
gaacctgacaaaacaggggagaataaagcacccagtaagttccagtccgtgggagtgcaa
gtagaagaagagaagtgcttccgcaggttcactcgatccaacagtgtgacgacagcagta
caggccgacctggacttccatgataatctggaaaattctctggaatctatagaggacaat
tcgtgtcctggccccatggccagacagttctcccgcgatgccagcacctccacagtcagc
attcagggctcaggaaaccattaccatgcctgtgccgccgatgatgactttgacacggat
tttgacccctctattctgcctcctccggacccctggattgactctatcactgaagaccct
ctggaggccgtgcaaaggtcagtgtgccaccgggatggccactggttcctgaagcttctc
caggcagagcgagaccgcatggaggggtggtgtcaacagatggagcgggaagaacgggaa
aacaacctgcccgaagacattctaggaaaaatccgaaccgcagtgggcagtgcccaactt
ctcatggcccagaaattctaccagttcagagaactgtgtgaagaaaacctgaatcctaat
gctcatccaagacccacctcccaggatttggcggggttttgggacatgctgcagttgtcc
atagaaaatattagtatgaaatttgatgaacttcatcagttaaaggccaataattggaaa
cagatggatcctcttgacaagaaggagagaagggcccctcctccagtgccaaagaagccg
gcgaagggccccgcgccgctgatccgggagcgctcgctggagagctcgcagcgccaggag
gcccgcaagcgcctgatggccgccaagcgcgccgcgtccgtccgccagaactcggccacc
gagagcgccgagagcatcgagatctacatccccgaggcgcagacccggctctga

DBGET integrated database retrieval system