KEGG   Homo sapiens (human): 92359
Entry
92359             CDS       T01001                                 

Gene name
CRB3
Definition
(RefSeq) crumbs cell polarity complex component 3
  KO
K06090  crumbs 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00344  CRB3-Pals1-PATJ complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    92359 (CRB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    92359 (CRB3)
SSDB
Motif
Pfam: Trp_oprn_chp DUF4690 DUF2165 Epiglycanin_C TMEM154 CcmH
Other DBs
NCBI-GeneID: 92359
NCBI-ProteinID: NP_631900
OMIM: 609737
HGNC: 20237
Ensembl: ENSG00000130545
Vega: OTTHUMG00000181828
Pharos: Q9BUF7(Tbio)
UniProt: Q9BUF7
LinkDB
Position
19p13.3
AA seq 120 aa
MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAI
IVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcgaaccccgggctggggctgcttctggcgctgggcctgccgttcctgctggcccgc
tggggccgagcctgggggcaaatacagaccacttctgcaaatgagaatagcactgttttg
ccttcatccaccagctccagctccgatggcaacctgcgtccagaagccatcactgctatc
atcgtggtcttctccctcttggctgccttgctcctggctgtggggctggcactgttggtg
cggaagcttcgggagaagcggcagacggagggcacctaccggcccagtagcgaggagcag
gtgggtgcccgcgtgccaccgacccccaacctcaagttgccgccggaagagcggctcatc
tga

DBGET integrated database retrieval system