KEGG   Homo sapiens (human): 924Help
Entry
924               CDS       T01001                                 

Gene name
CD7, GP40, LEU-9, TP41, Tp40
Definition
(RefSeq) CD7 molecule
  KO
K06457  T-cell surface glycoprotein CD7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    924 (CD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    924 (CD7)
CD molecules [BR:hsa04090]
 Proteins
  924 (CD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 924
NCBI-ProteinID: NP_006128
OMIM: 186820
HGNC: 1695
Ensembl: ENSG00000173762
Vega: OTTHUMG00000178662
Pharos: P09564(Tbio)
UniProt: P09564 Q29VG3
LinkDB All DBs
Position
17q25.3
AA seq 240 aa AA seqDB search
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR
QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV
NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcctccgaggctcctgctgctgcccctgcttctggcgctggctcgcggcctg
cctggggccctggctgcccaagaggtgcagcagtctccccactgcacgactgtccccgtg
ggagcctccgtcaacatcacctgctccaccagcgggggcctgcgtgggatctacctgagg
cagctcgggccacagccccaagacatcatttactacgaggacggggtggtgcccactacg
gacagacggttccggggccgcatcgacttctcagggtcccaggacaacctgactatcacc
atgcaccgcctgcagctgtcggacactggcacctacacctgccaggccatcacggaggtc
aatgtctacggctccggcaccctggtcctggtgacagaggaacagtcccaaggatggcac
agatgctcggacgccccaccaagggcctctgccctccctgccccaccgacaggctccgcc
ctccctgacccgcagacagcctctgccctccctgacccgccagcagcctctgccctccct
gcggccctggcggtgatctccttcctcctcgggctgggcctgggggtggcgtgtgtgctg
gcgaggacacagataaagaaactgtgctcgtggcgggataagaattcggcggcatgtgtg
gtgtacgaggacatgtcgcacagccgctgcaacacgctgtcctcccccaaccagtaccag
tga

DBGET integrated database retrieval system