KEGG   Homo sapiens (human): 92747Help
Entry
92747             CDS       T01001                                 

Gene name
BPIFB1, C20orf114, LPLUNC1
Definition
(RefSeq) BPI fold containing family B member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP LBP_BPI_CETP_C
Motif
Other DBs
NCBI-GeneID: 92747
NCBI-ProteinID: NP_149974
HGNC: 16108
Ensembl: ENSG00000125999
Vega: OTTHUMG00000032252
Pharos: Q8TDL5(Tbio)
UniProt: Q8TDL5
LinkDB All DBs
Position
20q11.21
AA seq 484 aa AA seqDB search
MAGPWTFTLLCGLLAATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLS
AMREKPAGGIPVLGSLVNTVLKHIIWLKVITANILQLQVKPSANDQELLVKIPLDMVAGF
NTPLVKTIVEFHMTTEAQATIRMDTSASGPTRLVLSDCATSHGSLRIQLLHKLSFLVNAL
AKQVMNLLVPSLPNLVKNQLCPVIEASFNGMYADLLQLVKVPISLSIDRLEFDLLYPAIK
GDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPFSLIVSQDVVKAAVAAVLSPE
EFMVLLDSVLPESAHRLKSSIGLINEKAADKLGSTQIVKILTQDTPEFFIDQGHAKVAQL
IVLEVFPSSEALRPLFTLGIEASSEAQFYTKGDQLILNLNNISSDRIQLMNSGIGWFQPD
VLKNIITEIIHSILLPNQNGKLRSGVPVSLVKALGFEAAESSLTKDALVLTPASLWKPSS
PVSQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggccggcccgtggaccttcacccttctctgtggtttgctggcagccaccttgatccaa
gccaccctcagtcccactgcagttctcatcctcggcccaaaagtcatcaaagaaaagctg
acacaggagctgaaggaccacaacgccaccagcatcctgcagcagctgccgctgctcagt
gccatgcgggaaaagccagccggaggcatccctgtgctgggcagcctggtgaacaccgtc
ctgaagcacatcatctggctgaaggtcatcacagctaacatcctccagctgcaggtgaag
ccctcggccaatgaccaggagctgctagtcaagatccccctggacatggtggctggattc
aacacgcccctggtcaagaccatcgtggagttccacatgacgactgaggcccaagccacc
atccgcatggacaccagtgcaagtggccccacccgcctggtcctcagtgactgtgccacc
agccatgggagcctgcgcatccaactgctgcataagctctccttcctggtgaacgcctta
gctaagcaggtcatgaacctcctagtgccatccctgcccaatctagtgaaaaaccagctg
tgtcccgtgatcgaggcttccttcaatggcatgtatgcagacctcctgcagctggtgaag
gtgcccatttccctcagcattgaccgtctggagtttgaccttctgtatcctgccatcaag
ggtgacaccattcagctctacctgggggccaagttgttggactcacagggaaaggtgacc
aagtggttcaataactctgcagcttccctgacaatgcccaccctggacaacatcccgttc
agcctcatcgtgagtcaggacgtggtgaaagctgcagtggctgctgtgctctctccagaa
gaattcatggtcctgttggactctgtgcttcctgagagtgcccatcggctgaagtcaagc
atcgggctgatcaatgaaaaggctgcagataagctgggatctacccagatcgtgaagatc
ctaactcaggacactcccgagttttttatagaccaaggccatgccaaggtggcccaactg
atcgtgctggaagtgtttccctccagtgaagccctccgccctttgttcaccctgggcatc
gaagccagctcggaagctcagttttacaccaaaggtgaccaacttatactcaacttgaat
aacatcagctctgatcggatccagctgatgaactctgggattggctggttccaacctgat
gttctgaaaaacatcatcactgagatcatccactccatcctgctgccgaaccagaatggc
aaattaagatctggggtcccagtgtcattggtgaaggccttgggattcgaggcagctgag
tcctcactgaccaaggatgcccttgtgcttactccagcctccttgtggaaacccagctct
cctgtctcccagtga

DBGET integrated database retrieval system