KEGG   Homo sapiens (human): 928Help
Entry
928               CDS       T01001                                 

Gene name
CD9, BTCC-1, DRAP-27, MIC3, MRP-1, TSPAN-29, TSPAN29
Definition
(RefSeq) CD9 molecule
  KO
K06460  CD9 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    928 (CD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    928 (CD9)
   04090 CD molecules [BR:hsa04090]
    928 (CD9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   928 (CD9)
CD molecules [BR:hsa04090]
 Proteins
  928 (CD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin CD20 IBV_3C
Motif
Other DBs
NCBI-GeneID: 928
NCBI-ProteinID: NP_001760
OMIM: 143030
HGNC: 1709
Ensembl: ENSG00000010278
Vega: OTTHUMG00000044400
Pharos: P21926(Tbio)
UniProt: P21926
LinkDB All DBs
Position
12p13.31
AA seq 228 aa AA seqDB search
MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
YILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKE
VQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKS
CPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaaaggaggcaccaagtgcatcaaatacctgctgttcggatttaacttcatc
ttctggcttgccgggattgctgtccttgccattggactatggctccgattcgactctcag
accaagagcatcttcgagcaagaaactaataataataattccagcttctacacaggagtc
tatattctgatcggagccggcgccctcatgatgctggtgggcttcctgggctgctgcggg
gctgtgcaggagtcccagtgcatgctgggactgttcttcggcttcctcttggtgatattc
gccattgaaatagctgcggccatctggggatattcccacaaggatgaggtgattaaggaa
gtccaggagttttacaaggacacctacaacaagctgaaaaccaaggatgagccccagcgg
gaaacgctgaaagccatccactatgcgttgaactgctgtggtttggctgggggcgtggaa
cagtttatctcagacatctgccccaagaaggacgtactcgaaaccttcaccgtgaagtcc
tgtcctgatgccatcaaagaggtcttcgacaataaattccacatcatcggcgcagtgggc
atcggcattgccgtggtcatgatatttggcatgatcttcagtatgatcttgtgctgtgct
atccgcaggaaccgcgagatggtctag

DBGET integrated database retrieval system