KEGG   Homo sapiens (human): 9290Help
Entry
9290              CDS       T01001                                 

Gene name
GPR55, LPIR1
Definition
(RefSeq) G protein-coupled receptor 55
  KO
K08413  G protein-coupled receptor 55
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9290 (GPR55)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidylinositol
    9290 (GPR55)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx XTBD
Motif
Other DBs
NCBI-GeneID: 9290
NCBI-ProteinID: NP_005674
OMIM: 604107
HGNC: 4511
Ensembl: ENSG00000135898
Vega: OTTHUMG00000133224
Pharos: Q9Y2T6(Tbio)
UniProt: Q9Y2T6 A8K858
LinkDB All DBs
Position
2q37.1
AA seq 319 aa AA seqDB search
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaaaacaccagtggggactgcctgtttgacggtgtcaacgagctgatgaaa
accctacagtttgcagtccacatccccaccttcgtcctgggcctgctcctcaacctgctg
gccatccatggcttcagcaccttccttaagaacaggtggcccgattatgctgccacctcc
atctacatgatcaacctggcagtctttgacctgctgctggtgctctccctcccattcaag
atggtcctgtcccaggtacagtcccccttcccgtccctgtgcaccctggtggagtgcctt
tacttcgtcagcatgtacggaagcgtcttcaccatctgcttcatcagcatggaccggttc
ttggccatccgttacccgctactggtgagccacctccggtcccccaggaagatctttggg
atctgctgcaccatctgggtcctggtgtggaccggaagcatccctatctacagtttccat
gggaaagtggaaaaatacatgtgcttccacaacatgtctgatgatacctggagcgccaag
gtcttcttcccgctggaggtgtttggcttcctccttcccatgggcatcatgggcttctgc
tgctccaggagcatccacatcctgctgggccgccgagaccacacccaggactgggtgcag
cagaaagcctgcatctacagcatcgcagccagcctggctgtcttcgtggtctccttcctc
ccagtccacctggggttcttcctgcagttcctggtgagaaacagctttatcgtagagtgc
agagccaagcagagcatcagcttcttcttgcaattgtccatgtgtttctccaacgtcaac
tgctgcctggatgttttctgctactactttgtcatcaaagaattccgcatgaacatcagg
gcccaccggccttccagggtccagctggtcctgcaggacaccacgatctcccggggctaa

DBGET integrated database retrieval system