KEGG   Homo sapiens (human): 93
Entry
93                CDS       T01001                                 

Gene name
ACVR2B, ACTRIIB, ActR-IIB, HTX4
Definition
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00632  Heterotaxy
Drug target
Bimagrumab: D10620
Luspatercept: D11701<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    93 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    93 (ACVR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    93 (ACVR2B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    93 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    93 (ACVR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     93 (ACVR2B)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   93 (ACVR2B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 93
NCBI-ProteinID: NP_001097
OMIM: 602730
HGNC: 174
Ensembl: ENSG00000114739
Vega: OTTHUMG00000131291
Pharos: Q13705(Tchem)
UniProt: Q13705
LinkDB
Structure
PDB: 
2H62 5NGV 2QLU 5NHR 4FAO

Position
3p22.2
AA seq 512 aa
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgacggcgccctgggtggccctcgccctcctctggggatcgctgtgcgccggctctggg
cgtggggaggctgagacacgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgaaggcgagcaggacaagcggctgcactgctac
gcctcctggcgcaacagctctggcaccatcgagctcgtgaagaagggctgctggctagat
gacttcaactgctacgataggcaggagtgtgtggccactgaggagaacccccaggtgtac
ttctgctgctgtgaaggcaacttctgcaacgaacgcttcactcatttgccagaggctggg
ggcccggaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcactgctgcccatcgggggcctttccctcatcgtcctgctggccttttggatgtac
cggcatcgcaagcccccctacggtcatgtggacatccatgaggaccctgggcctccacca
ccatcccctctggtgggcctgaagccactgcagctgctggagatcaaggctcgggggcgc
tttggctgtgtctggaaggcccagctcatgaatgactttgtagctgtcaagatcttccca
ctccaggacaagcagtcgtggcagagtgaacgggagatcttcagcacacctggcatgaag
cacgagaacctgctacagttcattgctgccgagaagcgaggctccaacctcgaagtagag
ctgtggctcatcacggccttccatgacaagggctccctcacggattacctcaaggggaac
atcatcacatggaacgaactgtgtcatgtagcagagacgatgtcacgaggcctctcatac
ctgcatgaggatgtgccctggtgccgtggcgagggccacaagccgtctattgcccacagg
gactttaaaagtaagaatgtattgctgaagagcgacctcacagccgtgctggctgacttt
ggcttggctgttcgatttgagccagggaaacctccaggggacacccacggacaggtaggc
acgagacggtacatggctcctgaggtgctcgagggagccatcaacttccagagagatgcc
ttcctgcgcattgacatgtatgccatggggttggtgctgtgggagcttgtgtctcgctgc
aaggctgcagacggacccgtggatgagtacatgctgccctttgaggaagagattggccag
cacccttcgttggaggagctgcaggaggtggtggtgcacaagaagatgaggcccaccatt
aaagatcactggttgaaacacccgggcctggcccagctttgtgtgaccatcgaggagtgc
tgggaccatgatgcagaggctcgcttgtccgcgggctgtgtggaggagcgggtgtccctg
attcggaggtcggtcaacggcactacctcggactgtctcgtttccctggtgacctctgtc
accaatgtggacctgccccctaaagagtcaagcatctaa

DBGET integrated database retrieval system