KEGG   Homo sapiens (human): 930Help
Entry
930               CDS       T01001                                 

Gene name
CD19, B4, CVID3
Definition
(RefSeq) CD19 molecule
  KO
K06465  B-lymphocyte antigen CD19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04662  B cell receptor signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency
Drug target
Axicabtagene ciloleucel: D11144
Blinatumomab: D09325
Denintuzumab: D11231
Denintuzumab mafodotin: D11232
Duvortuxizumab: D11372
Loncastuximab: D11333
Loncastuximab tesirine: D11338
Obexelimab: D11496
Tisagenlecleucel: D11386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    930 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    930 (CD19)
   04662 B cell receptor signaling pathway
    930 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    930 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    930 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    930 (CD19)
CD molecules [BR:hsa04090]
 Proteins
  930 (CD19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 V-set
Motif
Other DBs
NCBI-GeneID: 930
NCBI-ProteinID: NP_001761
OMIM: 107265
HGNC: 1633
Ensembl: ENSG00000177455
Vega: OTTHUMG00000097049
Pharos: P15391(Tclin)
UniProt: P15391
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 556 aa AA seqDB search
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
DPAWGGGGRMGTWSTR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcctcgcctcctcttcttcctcctcttcctcacccccatggaagtcaggccc
gaggaacctctagtggtgaaggtggaagagggagataacgctgtgctgcagtgcctcaag
gggacctcagatggccccactcagcagctgacctggtctcgggagtccccgcttaaaccc
ttcttaaaactcagcctggggctgccaggcctgggaatccacatgaggcccctggccatc
tggcttttcatcttcaacgtctctcaacagatggggggcttctacctgtgccagccgggg
cccccctctgagaaggcctggcagcctggctggacagtcaatgtggagggcagcggggag
ctgttccggtggaatgtttcggacctaggtggcctgggctgtggcctgaagaacaggtcc
tcagagggccccagctccccttccgggaagctcatgagccccaagctgtatgtgtgggcc
aaagaccgccctgagatctgggagggagagcctccgtgtctcccaccgagggacagcctg
aaccagagcctcagccaggacctcaccatggcccctggctccacactctggctgtcctgt
ggggtaccccctgactctgtgtccaggggccccctctcctggacccatgtgcaccccaag
gggcctaagtcattgctgagcctagagctgaaggacgatcgcccggccagagatatgtgg
gtaatggagacgggtctgttgttgccccgggccacagctcaagacgctggaaagtattat
tgtcaccgtggcaacctgaccatgtcattccacctggagatcactgctcggccagtacta
tggcactggctgctgaggactggtggctggaaggtctcagctgtgactttggcttatctg
atcttctgcctgtgttcccttgtgggcattcttcatcttcaaagagccctggtcctgagg
aggaaaagaaagcgaatgactgaccccaccaggagattcttcaaagtgacgcctccccca
ggaagcgggccccagaaccagtacgggaacgtgctgtctctccccacacccacctcaggc
ctcggacgcgcccagcgttgggccgcaggcctggggggcactgccccgtcttatggaaac
ccgagcagcgacgtccaggcggatggagccttggggtcccggagcccgccgggagtgggc
ccagaagaagaggaaggggagggctatgaggaacctgacagtgaggaggactccgagttc
tatgagaacgactccaaccttgggcaggaccagctctcccaggatggcagcggctacgag
aaccctgaggatgagcccctgggtcctgaggatgaagactccttctccaacgctgagtct
tatgagaacgaggatgaagagctgacccagccggtcgccaggacaatggacttcctgagc
cctcatgggtcagcctgggaccccagccgggaagcaacctccctggggtcccagtcctat
gaggatatgagaggaatcctgtatgcagccccccagctccgctccattcggggccagcct
ggacccaatcatgaggaagatgcagactcttatgagaacatggataatcccgatgggcca
gacccagcctggggaggagggggccgcatgggcacctggagcaccaggtga

DBGET integrated database retrieval system