KEGG   Homo sapiens (human): 9306Help
Entry
9306              CDS       T01001                                 

Gene name
SOCS6, CIS-4, CIS4, HSPC060, SOCS-4, SOCS-6, SOCS4, SSI4, STAI4, STATI4
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9306 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    9306 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9306 (SOCS6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9306 (SOCS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 9306
NCBI-ProteinID: NP_004223
OMIM: 605118
HGNC: 16833
Ensembl: ENSG00000170677
Vega: OTTHUMG00000132816
Pharos: O14544(Tbio)
UniProt: O14544 A0A024R379
LinkDB All DBs
Structure
PDB: 

Position
18q22.2
AA seq 535 aa AA seqDB search
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttatttggtagctgctatggtaaagatatggccagctgcgatatcaacggtgaagat
gaaaaaggcggaaaaaacagatcaaaaagcgagagcctgatgggtacgctaaaaaggcgg
ctttctgcaaaacagaagtcaaaaggcaaggcgggcacaccctctgggagctctgccgac
gaggacaccttctcctcctcctcagcacccatagtctttaaagacgtgagagctcagagg
ccgataaggtccacgtcgctccgcagccatcactacagtcccgcgccgtggcctctgcgg
cccacaaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagtccagccctgaatggcgtccggaaggatttccacgacctccagtct
gagaccacgtgccaggagcaagccaattcactgaagagctcggcttctcataatggagac
ctgcatcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacggagctat
tgtctggacagctcttctcccatggaagtctctgcggttcctcctcaagtgggagggcgc
gctttccccgaggatgagagtcaggtagaccaggacctagttgtcgccccagagatcttc
gtggatcagtccgtgaatggcttgttgattggcaccacgggagtcatgttgcagagcccg
agagcgggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgctgtcatttgaattttgatccgaactctgctcctggggttgcaagagtttatgactca
gtgcaaagtagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgca
aagcaaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttaccttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacagccagatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

DBGET integrated database retrieval system