KEGG   Homo sapiens (human): 9314
Entry
9314              CDS       T01001                                 

Gene name
KLF4, EZF, GKLF
Definition
(RefSeq) Kruppel like factor 4
  KO
K17846  krueppel-like factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H01556  Meningioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    9314 (KLF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9314 (KLF4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    9314 (KLF4)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 9314
NCBI-ProteinID: NP_001300981
OMIM: 602253
HGNC: 6348
Ensembl: ENSG00000136826
Vega: OTTHUMG00000020449
Pharos: O43474(Tbio)
UniProt: O43474
LinkDB
Position
9q31.2
AA seq 513 aa
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRH
YRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaggcagccacctggcgagtctgacatggctgtcagcgacgcgctgctcccatctttc
tccacgttcgcgtctggcccggcgggaagggagaagacactgcgtcaagcaggtgccccg
aataaccgctggcgggaggagctctcccacatgaagcgacttcccccagtgcttcccggc
cgcccctatgacctggcggcggcgaccgtggccacagacctggagagcggcggagccggt
gcggcttgcggcggtagcaacctggcgcccctacctcggagagagaccgaggagttcaac
gatctcctggacctggactttattctctccaattcgctgacccatcctccggagtcagtg
gccgccaccgtgtcctcgtcagcgtcagcctcctcttcgtcgtcgccgtcgagcagcggc
cctgccagcgcgccctccacctgcagcttcacctatccgatccgggccgggaacgacccg
ggcgtggcgccgggcggcacgggcggaggcctcctctatggcagggagtccgctccccct
ccgacggctcccttcaacctggcggacatcaacgacgtgagcccctcgggcggcttcgtg
gccgagctcctgcggccagaattggacccggtgtacattccgccgcagcagccgcagccg
ccaggtggcgggctgatgggcaagttcgtgctgaaggcgtcgctgagcgcccctggcagc
gagtacggcagcccgtcggtcatcagcgtcagcaaaggcagccctgacggcagccacccg
gtggtggtggcgccctacaacggcgggccgccgcgcacgtgccccaagatcaagcaggag
gcggtctcttcgtgcacccacttgggcgctggaccccctctcagcaatggccaccggccg
gctgcacacgacttccccctggggcggcagctccccagcaggactaccccgaccctgggt
cttgaggaagtgctgagcagcagggactgtcaccctgccctgccgcttcctcccggcttc
catccccacccggggcccaattacccatccttcctgcccgatcagatgcagccgcaagtc
ccgccgctccattaccaaggtcagtcccggggatttgtagctcgggctggggagccctgt
gtgtgctggccccacttcgggacacacgggatgatgctcaccccaccttcttcaccccta
gagctcatgccacccggttcctgcatgccagaggagcccaagccaaagaggggaagacga
tcgtggccccggaaaaggaccgccacccacacttgtgattacgcgggctgcggcaaaacc
tacacaaagagttcccatctcaaggcacacctgcgaacccacacaggtgagaaaccttac
cactgtgactgggacggctgtggatggaaattcgcccgctcagatgaactgaccaggcac
taccgtaaacacacggggcaccgcccgttccagtgccaaaaatgcgaccgagcattttcc
aggtcggaccacctcgccttacacatgaagaggcatttttaa

DBGET integrated database retrieval system