KEGG   Homo sapiens (human): 933Help
Entry
933               CDS       T01001                                 

Gene name
CD22, SIGLEC-2, SIGLEC2
Definition
(RefSeq) CD22 molecule
  KO
K06467  CD22 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04640  Hematopoietic cell lineage
hsa04662  B cell receptor signaling pathway
Drug target
Bectumomab: D03066
Epratuzumab: D04036
Inotuzumab ozogamicin: D08933
Moxetumomab pasudotox: D09932
Yttrium Y 90 epratuzumab: D06348
Yttrium Y 90 epratuzumab tetraxetan: D06349
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    933 (CD22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    933 (CD22)
   04662 B cell receptor signaling pathway
    933 (CD22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    933 (CD22)
   04091 Lectins [BR:hsa04091]
    933 (CD22)
CD molecules [BR:hsa04090]
 Proteins
  933 (CD22)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  933 (CD22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set C2-set_2 Ig_4 Ig_5 C1-set Ig_6 Izumo-Ig ICAM_N Cu2_monoox_C Invasin_D3
Motif
Other DBs
NCBI-GeneID: 933
NCBI-ProteinID: NP_001762
OMIM: 107266
HGNC: 1643
Ensembl: ENSG00000012124
Vega: OTTHUMG00000183298
Pharos: P20273(Tchem)
UniProt: P20273 Q0EAF5
LinkDB All DBs
Structure
PDB: 

Position
19q13.12
AA seq 847 aa AA seqDB search
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT
TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES
SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcggcccctggctcctgctcctggttctagaatacttggctttctctgac
tcaagtaaatgggtttttgagcaccctgaaaccctctacgcctgggagggggcctgcgtc
tggatcccctgcacctacagagccctagatggtgacctggaaagcttcatcctgttccac
aatcctgagtataacaagaacacctcgaagtttgatgggacaagactctatgaaagcaca
aaggatgggaaggttccttctgagcagaaaagggtgcaattcctgggagacaagaataag
aactgcacactgagtatccacccggtgcacctcaatgacagtggtcagctggggctgagg
atggagtccaagactgagaaatggatggaacgaatacacctcaatgtctctgaaaggcct
tttccacctcatatccagctccctccagaaattcaagagtcccaggaagtcactctgacc
tgcttgctgaatttctcctgctatgggtatccgatccaattgcagtggctcctagagggg
gttccaatgaggcaggctgctgtcacctcgacctccttgaccatcaagtctgtcttcacc
cggagcgagctcaagttctccccacagtggagtcaccatgggaagattgtgacctgccag
cttcaggatgcagatgggaagttcctctccaatgacacggtgcagctgaacgtgaagcac
accccgaagttggagatcaaggtcactcccagtgatgccatagtgagggagggggactct
gtgaccatgacctgcgaggtcagcagcagcaacccggagtacacgacggtatcctggctc
aaggatgggacctcgctgaagaagcagaatacattcacgctaaacctgcgcgaagtgacc
aaggaccagagtgggaagtactgctgtcaggtctccaatgacgtgggcccgggaaggtcg
gaagaagtgttcctgcaagtgcagtatgccccggaaccttccacggttcagatcctccac
tcaccggctgtggagggaagtcaagtcgagtttctttgcatgtcactggccaatcctctt
ccaacaaattacacgtggtaccacaatgggaaagaaatgcagggaaggacagaggagaaa
gtccacatcccaaagatcctcccctggcacgctgggacttattcctgtgtggcagaaaac
attcttggtactggacagaggggcccgggagctgagctggatgtccagtatcctcccaag
aaggtgaccacagtgattcaaaaccccatgccgattcgagaaggagacacagtgaccctt
tcctgtaactacaattccagtaaccccagtgttacccggtatgaatggaaaccccatggc
gcctgggaggagccatcgcttggggtgctgaagatccaaaacgttggctgggacaacaca
accatcgcctgcgcagcttgtaatagttggtgctcgtgggcctcccctgtcgccctgaat
gtccagtatgccccccgagacgtgagggtccggaaaatcaagcccctttccgagattcac
tctggaaactcggtcagcctccaatgtgacttctcaagcagccaccccaaagaagtccag
ttcttctgggagaaaaatggcaggcttctggggaaagaaagccagctgaattttgactcc
atctccccagaagatgctgggagttacagctgctgggtgaacaactccataggacagaca
gcgtccaaggcctggacacttgaagtgctgtatgcacccaggaggctgcgtgtgtccatg
agcccgggggaccaagtgatggaggggaagagtgcaaccctgacctgtgagagcgacgcc
aaccctcccgtctcccactacacctggtttgactggaataaccaaagcctcccctaccac
agccagaagctgagattggagccggtgaaggtccagcactcgggtgcctactggtgccag
gggaccaacagtgtgggcaagggccgttcgcctctcagcaccctcaccgtctactatagc
ccggagaccatcggcaggcgagtggctgtgggactcgggtcctgcctcgccatcctcatc
ctggcaatctgtgggctcaagctccagcgacgttggaagaggacacagagccagcagggg
cttcaggagaattccagcggccagagcttctttgtgaggaataaaaaggttagaagggcc
cccctctctgaaggcccccactccctgggatgctacaatccaatgatggaagatggcatt
agctacaccaccctgcgctttcccgagatgaacataccacgaactggagatgcagagtcc
tcagagatgcagagacctcccccggactgcgatgacacggtcacttattcagcattgcac
aagcgccaagtgggcgactatgagaacgtcattccagattttccagaagatgaggggatt
cattactcagagctgatccagtttggggtcggggagcggcctcaggcacaagaaaatgtg
gactatgtgatcctcaaacattga

DBGET integrated database retrieval system