KEGG   Homo sapiens (human): 93432Help
Entry
93432             CDS       T01001                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    93432 (MGAM2)
   00500 Starch and sucrose metabolism
    93432 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    93432 (MGAM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     93432 (MGAM2)
    3.2.1.20  alpha-glucosidase
     93432 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 93432
NCBI-ProteinID: NP_001280555
HGNC: 28101
Ensembl: ENSG00000257743
Vega: OTTHUMG00000158558
Pharos: Q2M2H8(Tdark)
UniProt: Q2M2H8
LinkDB All DBs
Position
7q34
AA seq 2515 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGIADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDARGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFFPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGSNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASNNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDSLLLKSSRH
YLNIRYTLLPYLYTLFYHAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAISWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDLEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLPMAPESAAAAASDSLSAKISFLHLKVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFIFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFAHDEPPAYKKNSYGVHPYYMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFHLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSNEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEHYNVHNLYG
WSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSIIGMMEFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
KVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPVL
ETSTFEISAYFPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSFTYDNRQFMETNFKSEPYNQILTIQLTDKTINLE
KLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTDTVPI
TTTSFPSTTSVTTNTTVPDTTSPFPTSTTNASTNATVPITTTPFPTSTIGVTTNATVPNT
TAPFPTNASTASTNATVPITTTCFATSTIGVTTNATVPDTTAPFPTNTTTASTNATIPIT
TTPFATSTISVTTSTTVPDTTAPFPTSTTSASTNATPVPITTTLFATSTIGVTTGTTVPD
TTAPFPTSTTSTSTSATVPITTTPSPTNTADANTSNTVPNTTMPSPTSSTTVSTIATVPI
SVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVAN
ITATSHTSTDDTVPNNTVPVTAIPSLANTGVDTTSNSFSIMTTSFSESTNAMNTTVIMAT
TSPTSTDVASTNNDASMTNFLLATMSAGNITSNSISITTTSFGNSVPFVTTPSPSTDATT
TSNNTNPGMTTYYQTSPTIPTHTLTSIPSSITSILSMFPTSNTFTTDKITNFTTPTNANT
IIFNTLDTKSTMVIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFATPHSATTTTLAL
SHTSLAPTNLSNLGTMDITDADNSSSVTGNTTHISVSNLTTASVTITATGLDSQTPHMVI
NSVATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPTYIANAINATQVP
NT seq 7548 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtg
accatagatatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccagtcggaaaggatagactgcacacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcgcctgtggcagatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccatcaccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggattgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccgccacaatatgacctggaagacttggcccatc
ttcacccgggacgctacccccaccgagggcatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagatgccaggggctcctcttttggagtatttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcgatcacttatcgcacgattggaggcatt
cttgacttttacgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttccctccctattggagtcttgggttccagcttagtcgcagg
gactatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatggacag
aaatatcttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggagcaatggctttgctgttggggaggga
tatccgggaccgacagtctttcccgattataccaatccagtatgcactgagtggtggaca
gatcaggtcgctaaatttcatgatcatctggagtttgatggagtgtggattgaaatgaat
gaagtatctagcttactccaagcttctaataaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatgggggccttcattatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccatcttcatgaataataggagcttcatcttatcc
cgttctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcccgctgcctttggtgttgattccctgctgctgaaatcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccatgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatctcatggaggaaacagttggtgaatatgcttctcccaggtgacaagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
gccagccggaggaattccctgggactcatcatcgccttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtgactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
atggacactgacaacctcatgttcacagatatcacaatcttgggaatggacaaacagcca
gctaattttatcgtcctactgaataatgttgccacctccagtccaagcgttgtctacaat
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacctggagaagttcaactgctaccctgatgat
ccaacagcctctgaggagagttgtaggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgatattcag
tacctgaacaccagcatcactgcagacctttccctcccgatggcccctgagtcagctgct
gctgccgcctctgattctctctctgcaaagatcagcttcctccacctgaaagtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtatgaggtt
ccagtaccactgaacacccctccccaaccagttggtgaccctgaaaaccgtctgtatgat
gtcaggattcagaacaatccttttggaatccagattcaacgcaaaaactccagcactgtg
atttgggattctcaactccctggcttcatcttcaatgacatgtttctctccatttctacg
cgtctgccgtcccagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgaactggaacacatggggaatgtttgctcatgatgagccacctgcgtacaagaag
aattcctatggtgtccacccttactacatggcactggaggaggatggtagtgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgctctgaca
taccgcaccacaggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgattggtcggccagcaatgattccatactgggccttg
ggattccatctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accaatgacattgtctggggaaaggtttggccagatctgcctaatgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctatgcaaaccct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagcaatgaaatgctaaataacccaccctat
atgccatatttggaatctagggacaagggcctgagcagcaagactctgtgcatggagagt
cagcagatcctgccggacagctcccccgtggagcactacaacgtgcacaacctgtacggg
tggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtc
atcatcacccgctccacatttccctcttctggacgctggggaggacaccggttgggaaac
aacacagctgcatgggaccagctggggaaatctatcattggcatgatggagttcagtctc
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
atcgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccaga
aaagtcctagagaccagatataccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcacagttgtccggccccttctccatgagtttacggatgacaggaca
acatgggatatagaccgtcagttcatgttgggccctgctatcttaatcagccctgtgttg
gaaactagcacatttgagatctctgcttattttccgagagcccgttggtatgactatagc
acgggaactagcagcacatcaacaggtcagaggaaaatcctgaaggctccccttgaccac
atcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgctatgaacact
cactccagtcgacaaaattttatgggattgattgttgctttggatgacaatgggacagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggcaaactttatagcagctcagaacatcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaagttgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagtttcacctatgacaaccggcaatttatggagacaaatttcaag
agtgaaccttataatcagatactaactattcaattgactgacaagactatcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactaagaca
agtaccatcccaatgagttctcatccttctccatctactaccaatgccaccagttctgag
acaatcaccagttctgccagtgcaaatactaccactggcactactgatactgttcctatc
acaaccacatctttcccaagtactactagtgttacaactaatactactgttcctgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacctttcccaacaagtactattggtgttacaactaatgctactgttcccaataca
actgcccctttcccaacaaatgctagtactgctagcactaatgctactgttcctatcaca
accacatgttttgcaacaagtactattggtgttacaactaatgctactgttcccgataca
actgcccctttcccaacaaatactactactgctagcactaatgctactattcctatcaca
accacaccttttgcaacaagtactattagtgttacaactagtactactgttcctgataca
actgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcctatc
acaaccacactttttgcaacaagtactattggtgttacaactggtactactgttcctgat
acaactgctcctttccctacaagtactactagtactagcactagtgctactgttcctatt
acaaccacaccttcccctacaaatactgctgatgctaacactagtaatactgttcctaat
accactatgccttctcctacaagtagtactactgtgagtactattgctaccgttcccatt
tcagtgactccttctctgacaagtactgctgatgccaccattagtactactgtacttatt
gccactacttcttctctaacaggtactactgatgttagcactagtactactattaataat
ataagtactcctgttcaaacaaatactactaatgctagcactagtactaatgttgctaat
ataactgctacctctcatacaagtactgatgatactgttcctaataatactgttccagtt
acagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttccatt
atgaccacttctttctctgaaagtactaatgctatgaacactactgttattatggcaact
acttctcctacaagtactgatgttgctagcacaaataatgatgcttctatgacaaatttt
cttttagctacaatgtctgctggtaatataactagtaatagtatttccataacaactact
tcttttggtaatagtgttccttttgtgactactccttctccaagtactgatgctactact
acaagtaataatactaatcctggcatgactacttattaccagacttctcctaccattcct
acccatactcttacttctattcctagctctattacttctattttgagcatgtttccaaca
agtaatacattcactactgataaaattactaattttactacccctacaaatgcaaacacc
attattttcaacactcttgatacaaaaagtaccatggtaatagatgctacggtcactact
accagcaccaaagataataccatgagtccagatacaacagttacttccatagacaaattc
accacacacatcacacagttcgctactccccattctgctactactacaacactggcctta
agccacacctcattagctcctacaaatctttctaatctaggcaccatggatattactgat
gcagataactccagcagtgttacaggtaacacgacacacatttctgtttcaaatctcaca
acagcctcagtcacaataacagccactggtctagattcacaaactccccatatggtaata
aattctgtggctacttatttacctattactgcaactagtgctaccacagatactacaaat
attacaaaatatgctttaaatactaccactcctgatagtacagtacatacctctgctact
gcacctacttatattgcaaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system