KEGG   Homo sapiens (human): 93643
Entry
93643             CDS       T01001                                 

Gene name
TJAP1, PILT, TJP4
Definition
(RefSeq) tight junction associated protein 1
  KO
K06105  tight junction protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    93643 (TJAP1)
SSDB
Motif
Pfam: Pilt Spc7 DUF1672 HMMR_N ERM Wtap
Other DBs
NCBI-GeneID: 93643
NCBI-ProteinID: NP_001139488
OMIM: 612658
HGNC: 17949
Ensembl: ENSG00000137221
Vega: OTTHUMG00000014736
Pharos: Q5JTD0(Tbio)
UniProt: Q5JTD0
LinkDB
Position
6p21.1
AA seq 557 aa
MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASAT
RRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLA
SLSHSWIFAIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLK
CNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPE
SLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGS
PEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISL
SLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAPASSASSEEDLLVSWQRAFVD
RTPPPAAVAQRTAFGRDALPELQRHFAHSPADRDEVVQAPSARPEESELLLPTEPDSGFP
REEEELNLPISPEEERQSLLPINRGTEEGPGTSHTEGRAWPLPSSSRPQRSPKRMGVHHL
HRKDSLTQAQEQGNLLN
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgactagtgccgcccctgctaagaaaccctaccgtaaggcaccaccagagcatcgggag
ctgcgtttggaaattcctggatcccggcttgagcaggaggaacccctgactgatgcagaa
aggatgaagctcttacaggaggagaatgaagagcttcgccggcgcctggcctccgccacc
agacgcactgaggccctggaacgtgagctggaaattgggcaggactgcctggagctggag
ctgggccagagccgcgaggagctggacaaatttaaggataagttccgcaggctgcagaac
agctacacggcttcccagcggaccaaccaggagttggaggacaagctgcacacactggcc
tctcttagccacagctggatttttgcaatcaagaaggctgagatggataggaagacgctg
gactgggagattgtggagctgaccaacaagctgctggatgccaagaacaccatcaacaag
ctggaagagctcaatgagcggtaccggctggactgcaacctggctgtacagctcctcaag
tgcaacaagtcccacttccgaaaccacaagtttgccgatctgccctgtgagctacaggac
atggttcggaaacatttgcacagtggtcaagaggccgccagcccaggtcctgctcccagc
ctagccccaggggctgtggtgcctacctcagtcattgcccgagtgttagagaagccggag
tctctactgctcaattcagcccagtcaggcagcgccgggcgccccttggctgaggatgtc
tttgtgcatgtggacatgagtgagggtgtcccaggtgatccagccagtcccccggcccct
ggcagccccaccccacaacccaatggggagtgccactctctgggtactgccaggggctcc
ccggaggaagagctgcccctgccagcctttgagaagctgaacccctacccaaccccgtct
ccaccacacccactgtatcctggccgcagggtaatagagttctctgaggataaggttcgg
atcccccgcaacagccccctgcccaactgcacttacgctacccgccaggccatttccctg
agcctggtagaggaggggagtgagcgggcccgccccagcccagtgcccagcacccctgcc
tcagcccaggcctcaccccaccaccagcccagcccagcacccctaacactcagtgcccca
gctagctctgccagctctgaagaggacctgctggtcagctggcagcgggcatttgtggac
cgtactccaccacctgctgctgtggcccagcgcacagcctttggacgcgatgccctccct
gagctgcagcgccattttgcccatagccccgctgacagagatgaggtggtccaggcacct
tctgcccgacccgaagagagtgagcttttgctacccacagaacctgactctggctttccc
agggaggaagaagagctgaacctgcctatcagtcctgaggaagagcgccagagcctgctg
cccattaacaggggcacagaggaggggccaggcacttcccacaccgagggcagggcctgg
ccactccccagctccagtcgcccccagcgcagccccaagaggatgggggttcaccacctg
caccgcaaggacagcctgacccaggcccaggagcagggcaacctgctcaactag

DBGET integrated database retrieval system