KEGG   Homo sapiens (human): 9365
Entry
9365              CDS       T01001                                 

Gene name
KL, HFTC3
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa01100  Metabolic pathways
hsa04211  Longevity regulating pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Disease
H01193  Familial tumoral calcinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    9365 (KL)
   00053 Ascorbate and aldarate metabolism
    9365 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9365 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    9365 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    9365 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9365 (KL)
   04147 Exosome [BR:hsa04147]
    9365 (KL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     9365 (KL)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   9365 (KL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9365 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 9365
NCBI-ProteinID: NP_004786
OMIM: 604824
HGNC: 6344
Ensembl: ENSG00000133116
Vega: OTTHUMG00000017408
Pharos: Q9UEF7(Tbio)
UniProt: Q9UEF7
LinkDB
Structure
PDB: 
5W21

Position
13q13.1
AA seq 1012 aa
MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGT
FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPA
TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
KGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLE
RFCPEEFTVCTECSFFHTRKSLLAFIAFLFFASIISLSLIFYYSKKGRRSYK
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgtcgctgctg
ctggtgctgctgggcctgggcggccgccgcctgcgtgcggagccgggcgacggcgcgcag
acctgggcccgtttctcgcggcctcctgcccccgaggccgcgggcctcttccagggcacc
ttccccgacggcttcctctgggccgtgggcagcgccgcctaccagaccgagggcggctgg
cagcagcacggcaagggtgcgtccatctgggatacgttcacccaccaccccctggcaccc
ccgggagactcccggaacgccagtctgccgttgggcgccccgtcgccgctgcagcccgcc
accggggacgtagccagcgacagctacaacaacgtcttccgcgacacggaggcgctgcgc
gagctcggggtcactcactaccgcttctccatctcgtgggcgcgagtgctccccaatggc
agcgcgggcgtccccaaccgcgaggggctgcgctactaccggcgcctgctggagcggctg
cgggagctgggcgtgcagcccgtggtcaccctgtaccactgggacctgccccagcgcctg
caggacgcctacggcggctgggccaaccgcgccctggccgaccacttcagggattacgcg
gagctctgcttccgccacttcggcggtcaggtcaagtactggatcaccatcgacaacccc
tacgtggtggcctggcacggctacgccaccgggcgcctggcccccggcatccggggcagc
ccgcggctcgggtacctggtggcgcacaacctcctcctggctcatgccaaagtctggcat
ctctacaatacttctttccgtcccactcagggaggtcaggtgtccattgccctaagctct
cactggatcaatcctcgaagaatgaccgaccacagcatcaaagaatgtcaaaaatctctg
gactttgtactaggttggtttgccaaacccgtatttattgatggtgactatcccgagagc
atgaagaataacctttcatctattctgcctgattttactgaatctgagaaaaagttcatc
aaaggaactgctgacttttttgctctttgctttggacccaccttgagttttcaacttttg
gaccctcacatgaagttccgccaattggaatctcccaacctgaggcaactgctttcctgg
attgaccttgaatttaaccatcctcaaatatttattgtggaaaatggctggtttgtctca
gggaccaccaagagagatgatgccaaatatatgtattacctcaaaaagttcatcatggaa
accttaaaagccatcaagctggatggggtggatgtcatcgggtataccgcatggtccctc
atggatggtttcgagtggcacagaggttacagcatcaggcgtggactcttctatgttgac
tttctaagccaggacaagatgttgttgccaaagtcttcagccttgttctaccaaaagctg
atagagaaaaatggcttccctcctttacctgaaaatcagcccctagaagggacatttccc
tgtgactttgcttggggagttgttgacaactacattcaagtagataccactctgtctcag
tttaccgacctgaatgtttacctgtgggatgtccaccacagtaaaaggcttattaaagtg
gatggggttgtgaccaagaagaggaaatcctactgtgttgactttgctgccatccagccc
cagatcgctttactccaggaaatgcacgttacacattttcgcttctccctggactgggcc
ctgattctccctctgggtaaccagtcccaggtgaaccacaccatcctgcagtactatcgc
tgcatggccagcgagcttgtccgtgtcaacatcaccccagtggtggccctgtggcagcct
atggccccgaaccaaggactgccgcgcctcctggccaggcagggcgcctgggagaacccc
tacactgccctggcctttgcagagtatgcccgactgtgctttcaagagctcggccatcac
gtcaagctttggataacgatgaatgagccgtatacaaggaatatgacatacagtgctggc
cacaaccttctgaaggcccatgccctggcttggcatgtgtacaatgaaaagtttaggcat
gctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctgcctgccct
ttctcccaaaaggacaaagaggtggctgagagagttttggaatttgacattggctggctg
gctgagcccattttcggctctggagattatccatgggtgatgagggactggctgaaccaa
agaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatccagggtacc
tttgactttttggctttaagccattataccaccatccttgtagactcagaaaaagaagat
ccaataaaatacaatgattacctagaagtgcaagaaatgaccgacatcacgtggctcaac
tcccccagtcaggtggcggtagtgccctgggggttgcgcaaagtgctgaactggctgaag
ttcaagtacggagacctccccatgtacataatatccaatggaatcgatgacgggctgcat
gctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaagctctcaaa
gcccacatactggatggtatcaatctttgcggatactttgcttattcgtttaacgaccgc
acagctccgaggtttggcctctatcgttatgctgcagatcagtttgagcccaaggcatcc
atgaaacattacaggaaaattattgacagcaatggtttcccgggcccagaaactctggaa
agattttgtccagaagaattcaccgtgtgtactgagtgcagtttttttcacacccgaaag
tctttactggctttcatagcttttctattttttgcttctattatttctctctcccttata
ttttactactcgaagaaaggcagaagaagttacaaatag

DBGET integrated database retrieval system