KEGG   Homo sapiens (human): 9368
Entry
9368              CDS       T01001                                 

Gene name
SLC9A3R1, EBP50, NHERF, NHERF-1, NHERF1, NPHLOP2
Definition
(RefSeq) SLC9A3 regulator 1
  KO
K13365  sodium/hydrogen exchange regulatory cofactor NHE-RF1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00353  HPV E6 to PTEN-PIP3-AKT signaling pathway
N01095  Escherichia Map to LPA-GNA12/13-RhoA signaling pathway
Disease
H00888  Nephrolithiasis/osteoporosis, hypophosphatemic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9368 (SLC9A3R1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9368 (SLC9A3R1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9368 (SLC9A3R1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    9368 (SLC9A3R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9368 (SLC9A3R1)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   9368 (SLC9A3R1)
SSDB
Motif
Pfam: EBP50_C PDZ PDZ_6 PDZ_2 HoxA13_N
Other DBs
NCBI-GeneID: 9368
NCBI-ProteinID: NP_004243
OMIM: 604990
HGNC: 11075
Ensembl: ENSG00000109062
Vega: OTTHUMG00000178863
Pharos: O14745(Tbio)
UniProt: O14745
LinkDB
Structure
PDB: 

Position
17q25.1
AA seq 358 aa
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIR
SVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQ
DSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggcgcccctgccccggctctgctgcctggagaagggt
ccgaacggctacggcttccacctgcacggggagaagggcaagttgggccagtacatccgg
ctggtggagcccggctcgccggccgagaaggcggggctgctggcgggggaccggctggtg
gaggtgaacggcgaaaacgtggagaaggagacccaccagcaggtggtgagccgcatccgc
gccgcactcaacgccgtgcgcctgctggtggtcgaccccgagacggacgagcagctgcag
aagctcggcgtccaggtccgagaggagctgctgcgcgcccaggaagcgccggggcaggcc
gagccgccggccgccgccgaggtgcagggggctggcaacgaaaatgagcctcgcgaggcc
gacaagagccacccggagcagcgcgagcttcggcctcggctctgtaccatgaagaagggc
cccagtggctatggcttcaacctgcacagcgacaagtccaagccaggccagttcatccgg
tcagtggacccagactccccggctgaggcttcagggctccgggcccaggatcgcattgtg
gaggtgaacggggtctgcatggaggggaagcagcatggggacgtggtgtccgccatcagg
gctggcggggacgagaccaagctgctggtggtggacagggaaactgacgagttcttcaag
aaatgcagagtgatcccatctcaggagcacctgaatggtcccctgcctgtgcccttcacc
aatggggagatacagaaggagaacagtcgtgaagccctggcagaggcagccttggagagc
cccaggccagccctggtgagatccgcctccagtgacaccagcgaggagctgaattcccaa
gacagccccccaaaacaggactccacagcgccctcgtctacctcctcctccgaccccatc
ctagacttcaacatctccctggccatggccaaagagagggcccaccagaaacgcagcagc
aaacgggccccgcagatggactggagcaagaaaaacgaactcttcagcaacctctga

DBGET integrated database retrieval system