KEGG   Homo sapiens (human): 9377Help
Entry
9377              CDS       T01001                                 

Gene name
COX5A, COX, COX-VA, VA
Definition
(RefSeq) cytochrome c oxidase subunit 5A
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9377 (COX5A)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    9377 (COX5A)
  09159 Environmental adaptation
   04714 Thermogenesis
    9377 (COX5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9377 (COX5A)
   05012 Parkinson disease
    9377 (COX5A)
   05016 Huntington disease
    9377 (COX5A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9377 (COX5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX5A
Motif
Other DBs
NCBI-GeneID: 9377
NCBI-ProteinID: NP_004246
OMIM: 603773
HGNC: 2267
Ensembl: ENSG00000178741
Vega: OTTHUMG00000142825
Pharos: P20674(Tbio)
UniProt: P20674
LinkDB All DBs
Structure
PDB: 

Position
15q24.2
AA seq 150 aa AA seqDB search
MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYF
NKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHK
EIYPYVIQELRPTLNELGISTPEELGLDKV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgccgctctccgccgctgcgctgtggccgcaaccacccgggccgaccctcga
ggcctcctgcactccgcccggacccccggccccgccgtggctatccagtcagttcgctgc
tattcccatgggtcacaggagacagatgaggagtttgatgctcgctgggtaacatacttc
aacaagccagatatagatgcctgggaattgcgtaaagggataaacacacttgttacctat
gatatggttccagagcccaaaatcattgatgctgctttgcgggcatgcagacggttaaat
gattttgctagtacagttcgtatcctagaggttgttaaggacaaagcaggacctcataag
gaaatctacccctatgtcatccaggaacttagaccaactttaaatgaactgggaatctcc
actccggaggaactgggccttgacaaagtgtaa

DBGET integrated database retrieval system