KEGG   Homo sapiens (human): 9404
Entry
9404              CDS       T01001                                 

Gene name
LPXN, LDPL
Definition
(RefSeq) leupaxin
  KO
K24314  leupaxin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9404 (LPXN)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  Paxillin family proteins
   9404 (LPXN)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 9404
NCBI-ProteinID: NP_004802
OMIM: 605390
HGNC: 14061
Ensembl: ENSG00000110031
Vega: OTTHUMG00000167466
Pharos: O60711(Tbio)
UniProt: O60711
LinkDB
Structure
PDB: 
4XEF 1X3H

Position
11q12.1
AA seq 386 aa
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaagagttagatgccttattggaggaactggaacgctccacccttcaggacagtgat
gaatattccaacccagctcctcttcccctggatcagcattccagaaaggagactaacctt
gatgagacttcggagatcctttctattcaggataacacaagtcccttgccggcgcagctc
gtgtatactaccaatatccaggagctcaatgtctacagtgaagcccaagagccaaaggaa
tcaccaccaccttctaaaacgtcagcagctgctcagttggatgagctcatggctcacctg
actgagatgcaggccaaggttgcagtgagagcagatgctggcaagaagcacttaccagac
aagcaggatcacaaggcctccctggactcaatgcttgggggtctggagcaggaattgcag
gaccttggcattgccacagtgcccaagggccattgtgcatcctgccagaaaccgattgct
gggaaggtgatccatgctctagggcaatcatggcatcctgagcattttgtctgtactcat
tgcaaagaagagattggctccagtcccttctttgagcggagtggcttggcctactgcccc
aacgactaccaccaacttttttctccacgctgtgcttactgcgctgctcccatcctggat
aaagtgctgacagcaatgaaccagacctggcacccagagcacttcttctgctctcactgc
ggagaggtgtttggtgcagaaggctttcatgagaaggacaagaagccatattgccgaaag
gatttcttagccatgttctcacccaagtgtggtggctgcaatcgcccagtgttggaaaac
tacctttcagccatggacactgtctggcacccagagtgctttgtttgtggggactgcttc
accagtttttctactggctccttctttgaactggatggacgtccattctgtgagctccat
taccatcaccgccggggaacgctctgccatgggtgtgggcagcccatcactggccgttgt
atcagtgccatggggtacaagttccatcctgagcactttgtgtgtgctttctgcctgaca
cagttgtcgaagggcattttcagggagcagaatgacaagacctattgtcaaccttgcttc
aataagctcttcccactgtaa

DBGET integrated database retrieval system