KEGG   Homo sapiens (human): 94233Help
Entry
94233             CDS       T01001                                 

Gene name
OPN4, MOP
Definition
(RefSeq) opsin 4
  KO
K04255  r-opsin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    94233 (OPN4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    94233 (OPN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 94233
NCBI-ProteinID: NP_150598
OMIM: 606665
HGNC: 14449
Ensembl: ENSG00000122375
Vega: OTTHUMG00000018654
Pharos: Q9UHM6(Tbio)
UniProt: Q9UHM6
LinkDB All DBs
Position
10q23.2
AA seq 478 aa AA seqDB search
MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPL
PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMS
FTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFG
VASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLC
CFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL
VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVA
IAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW
THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctccttcggggccaagagtcccgcccagcccaacccaagagcccagctgcatg
gccaccccagcaccacccagctggtgggacagctcccagagcagcatctccagcctgggc
cggcttccatccatcagtcccacagcacctgggacttgggctgctgcctgggtccccctc
cccacggttgatgttccagaccatgcccactataccctgggcacagtgatcttgctggtg
ggactcacggggatgctgggcaacctgacggtcatctataccttctgcaggagcagaagc
ctccggacacctgccaacatgttcattatcaacctcgcggtcagcgacttcctcatgtcc
ttcacccaggcccctgtcttcttcaccagtagcctctataagcagtggctctttggggag
acaggctgcgagttctatgccttctgtggagctctctttggcatttcctccatgatcacc
ctgacggccatcgccctggaccgctacctggtaatcacacgcccgctggccacctttggt
gtggcgtccaagaggcgtgcggcatttgtcctgctgggcgtttggctctatgccctggcc
tggagtctgccacccttcttcggctggagcgcctacgtgcccgaggggttgctgacatcc
tgctcctgggactacatgagcttcacgccggccgtgcgtgcctacaccatgcttctctgc
tgcttcgtgttcttcctccctctgcttatcatcatctactgctacatcttcatcttcagg
gccatccgggagacaggacgggctctccagaccttcggggcctgcaagggcaatggcgag
tccctgtggcagcggcagcggctgcagagcgagtgcaagatggccaagatcatgctgctg
gtcatcctcctcttcgtgctctcctgggctccctattccgctgtggccctggtggccttt
gctgggtacgcacacgtcctgacaccctacatgagctcggtgccagccgtcatcgccaag
gcctctgcaatccacaaccccatcatttacgccatcacccaccccaagtacagggtggcc
attgcccagcacctgccctgcctgggggtgctgctgggtgtatcacgccggcacagtcgc
ccctaccccagctaccgctccacccaccgctccacgctgaccagccacacctccaacctc
agctggatctccatacggaggcgccaggagtccctgggctcggagagtgaggtgggctgg
acacacatggaggcagcagctgtgtggggagctgcccagcaagcaaatgggcggtccctc
tacggtcagggtctggaggacttggaagccaaggcaccccccagaccccagggacacgaa
gcagagactccagggaagaccaaggggctgatccccagccaggaccccaggatgtag

DBGET integrated database retrieval system