KEGG   Homo sapiens (human): 94274
Entry
94274             CDS       T01001                                 

Gene name
PPP1R14A, CPI-17, CPI17, PPP1INL
Definition
(RefSeq) protein phosphatase 1 regulatory inhibitor subunit 14A
  KO
K12328  protein phosphatase 1 regulatory subunit 14A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    94274 (PPP1R14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    94274 (PPP1R14A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     94274 (PPP1R14A)
SSDB
Motif
Pfam: PP1_inhibitor
Other DBs
NCBI-GeneID: 94274
NCBI-ProteinID: NP_150281
OMIM: 608153
HGNC: 14871
Ensembl: ENSG00000167641
Vega: OTTHUMG00000181892
Pharos: Q96A00(Tbio)
UniProt: Q96A00
LinkDB
Position
19q13.2
AA seq 147 aa
MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHR
QPGLRQPSPSHDGSLSPLQDRARTAHP
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcagctcagcggctgggcaagcgcgtgctgagcaagctgcagtctccatcgcgggcc
cgcgggccagggggcagtcccggggggctgcagaagcggcacgcgcgcgtcaccgtcaag
tatgaccggcgggagctgcagcggcggctggacgtggagaagtggatcgacgggcgcctg
gaggagctgtaccgcggcatggaggcagacatgcccgatgagatcaacattgatgaattg
ttggagttagagagtgaagaggagagaagccggaaaatccagggactcctgaagtcatgt
gggaaacctgtcgaggacttcatccaggagctgctggcaaagcttcaaggcctccacagg
cagcccggcctccgccagccaagcccctcccacgacggcagcctcagccccctccaggac
cgggcccggactgctcacccctga

DBGET integrated database retrieval system