KEGG   Homo sapiens (human): 9451Help
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Disease
H00512  Permanent neonatal diabetes mellitus
H00766  Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9451 (EIF2AK3)
   04137 Mitophagy - animal
    9451 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9451 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9451 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    9451 (EIF2AK3)
   05160 Hepatitis C
    9451 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    9451 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   9451 (EIF2AK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PQQ_2 Kdo APH OATP
Motif
Other DBs
NCBI-GeneID: 9451
NCBI-ProteinID: NP_004827
OMIM: 604032
HGNC: 3255
Ensembl: ENSG00000172071
Vega: OTTHUMG00000155046
Pharos: Q9NZJ5(Tchem)
UniProt: Q9NZJ5 B3KY45
LinkDB All DBs
Structure
PDB: 

Position
2p11.2
AA seq 1116 aa AA seqDB search
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system