KEGG   Homo sapiens (human): 9451
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01009  PERK-ATF4 signaling pathway
N01010  Mutation-caused aberrant PSEN1 to PERK-ATF4 signaling pathway
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01149  Mutation-caused aberrant SOD1 to PERK-ATF4 signaling pathway
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
Disease
H00512  Permanent neonatal diabetes mellitus
H00766  Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9451 (EIF2AK3)
   04137 Mitophagy - animal
    9451 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9451 (EIF2AK3)
   05012 Parkinson disease
    9451 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    9451 (EIF2AK3)
   05020 Prion disease
    9451 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    9451 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    9451 (EIF2AK3)
   05160 Hepatitis C
    9451 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    9451 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   9451 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 9451
NCBI-ProteinID: NP_004827
OMIM: 604032
HGNC: 3255
Ensembl: ENSG00000172071
Vega: OTTHUMG00000155046
Pharos: Q9NZJ5(Tchem)
UniProt: Q9NZJ5 B3KY45
LinkDB
Structure
PDB: 

Position
2p11.2
AA seq 1116 aa
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt   +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system