KEGG   Homo sapiens (human): 9488Help
Entry
9488              CDS       T01001                                 

Gene name
PIGB, EIEE80, GPI-MT-III, PIG-B
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class B
  KO
K05286  GPI mannosyltransferase 3 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    9488 (PIGB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    9488 (PIGB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     9488 (PIGB)
Glycosyltransferases [BR:hsa01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   9488 (PIGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_22 PMT_2
Motif
Other DBs
NCBI-GeneID: 9488
NCBI-ProteinID: NP_004846
OMIM: 604122
HGNC: 8959
Ensembl: ENSG00000069943
Vega: OTTHUMG00000172654
Pharos: Q92521(Tbio)
UniProt: Q92521
LinkDB All DBs
Position
15q21.3
AA seq 554 aa AA seqDB search
MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGEN
IYLLLFTIALRILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLI
FASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLC
SWFTWYCCTRTLTNTMETVLTIIALFYYPLEGSKSMNSVKYSSLVALAFIIRPTAVILWT
PLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFFGQWTLVQFNFLKFNVLQNWG
TFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLLVYSMLSHKEF
RFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQK
VCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNP
LNWLHREFHDDASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVY
ERKLKGKFNMKMKF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcccctaagcaagtgcggaatggagccggggggcggagatgccagcctcact
ttgcatggtctccagaaccgctcccacggcaagataaagctgcgaaagagaaagtctacc
ttgtacttcaacacccaggagaagagcgccaggcgccgcggggatcttcttggagaaaat
atttatctgctcttgtttaccatagctttacgaatattaaactgctttttagtgcagaca
agttttgttccagatgaatactggcagtctcttgaagtttcacatcacatggttttcaat
tatggttatttgacttgggaatggacagagagactgaggagttacacttatcccttaatc
tttgcaagcatttacaagattcttcatcttttagggaaagatagtgttcagttgctgatt
tggattcctagacttgcccaagcacttctgtctgctgtagcagatgtgagactttactca
ttaatgaagcaactagaaaatcaggaagtggcaagatgggtgtttttttgccagttgtgc
tcctggttcacatggtattgctgtaccagaacccttacaaacaccatggaaactgttctc
actataattgctcttttctactatcctttggaaggttcaaagtctatgaacagtgtcaaa
tactcatccctggtggcacttgccttcataattcgtcccacagctgtcattctgtggaca
cctttgctcttcagacatttctgtcaagaaccaagaaagcttgatcttattctacatcat
tttttacctgtaggctttgttactttgagtttgtctctgatgattgatcgtatttttttt
ggccaatggactctggttcaatttaattttttgaaatttaacgtgctgcagaactgggga
acattttatggttctcatccatggcactggtacttcagtcaaggatttccagttatcttg
ggtactcacttacccttctttattcatggctgctatctagcaccaaagagataccggata
cttttggtgactgtgctgtggacactgcttgtttatagcatgttgagccacaaagaattc
aggtttatttatccagttttaccattctgtatggtgttctgtggatactcattaacccac
ctgaaaacatggaagaaaccagctctaagtttcctgtttttatcaaatttgttcctcgcc
ctttatactggtttagttcatcaacgaggtactcttgatgtcatgagtcatattcaaaaa
gtttgttacaacaatcccaataaatcttcagcttcaatatttataatgatgccttgccac
tctactccttattacagccatgttcactgcccacttcccatgagatttctccagtgcccg
ccagacctgactggaaaaagtcattatcttgatgaagcagatgtattttacctaaatccc
ttaaactggttacatagagagtttcatgatgatgcatcattgcctactcacttgatcacc
ttcagcattttggaagaggaaataagcgctttcctaatttcaagcaattataaaagaact
gctgttttcttccacactcacttgccagagggtcgaattggaagtcacatatatgtctat
gaacggaagttaaaagggaaattcaacatgaagatgaaattctga

DBGET integrated database retrieval system