KEGG   Homo sapiens (human): 9514Help
Entry
9514              CDS       T01001                                 

Gene name
GAL3ST1, CST
Definition
(RefSeq) galactose-3-O-sulfotransferase 1
  KO
K01019  galactosylceramide sulfotransferase [EC:2.8.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00067  Sulfoglycolipids biosynthesis, ceramide/1-alkyl-2-acylglycerol => sulfatide/seminolipid
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    9514 (GAL3ST1)
   00600 Sphingolipid metabolism
    9514 (GAL3ST1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    9514 (GAL3ST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.11  galactosylceramide sulfotransferase
     9514 (GAL3ST1)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9514 (GAL3ST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-3-0_sulfotr
Motif
Other DBs
NCBI-GeneID: 9514
NCBI-ProteinID: NP_001305032
OMIM: 602300
HGNC: 24240
Ensembl: ENSG00000128242
Vega: OTTHUMG00000151200
Pharos: Q99999(Tbio)
UniProt: Q99999 A0A024R1D7
LinkDB All DBs
Position
22q12.2
AA seq 423 aa AA seqDB search
MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPE
AVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTF
FARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPV
VPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
EVERRFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNARRDSPVPRLSGELYGRATAW
NMLDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDE
AMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDF
LRW
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaccgcagaagaagccctgggagtccatggctaaggggctggtgctgggcgcg
ctcttcactagtttcctgctgctggtgtactcctatgccgtgcccccgctgcatgccggc
ctggcctccacgaccccggaggccgcagcgtcctgctctccacctgcactcgagccagag
gcagtgatccgggccaacggctcggcgggggagtgccagccgcggcgcaacatcgtgttc
ttgaagacgcacaagacggccagcagcaccctgctcaacatcctgttccgcttcggccag
aagcaccggctcaagttcgccttccctaacggccgcaatgacttcgactacccgaccttc
ttcgcccgcagcctggtgcaggactatcggcccggggcctgcttcaacatcatctgcaac
cacatgcgcttccactacgacgaggtgcgcggcctggtgccgaccaacgccatcttcatc
acggtgctccgcgaccccgcccgcttgttcgagtcctccttccactacttcgggccggtg
gtgcccctcacgtggaagctctcggccggcgacaagctgaccgagttcctgcaagacccg
gatcgctactacgaccccaacggcttcaatgcccactacctccgaaacctgctcttcttc
gacctgggctatgacaacagcctggaccccagcagcccgcaggtgcaggagcacatcctg
gaggtggagcgtcgcttccacctggtgctccttcaagagtacttcgacgagtcgctggtg
ctgctgaaggacctgctgtgctgggagctggaggacgtgctctacttcaagctcaacgcc
cgccgcgactcgcccgtgccgcggctctcgggggagctgtatgggcgcgccaccgcctgg
aacatgctggactcccacctctaccgccacttcaacgccagcttctggcgcaaggtggag
gccttcgggcgggagcgcatggcccgcgaggtggccgccctgcgccatgccaacgagcgc
atgcggaccatctgcatcgacgggggccacgccgtggacgccgccgccatccaggacgag
gccatgcagccctggcagccgctgggcaccaagtccatcctgggctacaacctcaagaag
agcatcgggcagcggcacgcgcagctctgccggcgcatgctcacgcccgagatccagtac
ctgatggacctcggcgccaacctgtgggtcaccaagctctggaagttcattcgcgatttc
ctgcggtggtga

DBGET integrated database retrieval system