KEGG   Homo sapiens (human): 9533Help
Entry
9533              CDS       T01001                                 

Gene name
POLR1C, AC40, HLD11, RPA39, RPA40, RPA5, RPAC1, RPC40, TCS3
Definition
(RefSeq) RNA polymerase I and III subunit C
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05169  Epstein-Barr virus infection
Module
hsa_M00181  RNA polymerase III, eukaryotes
hsa_M00182  RNA polymerase I, eukaryotes
Disease
H00610  Treacher Collins syndrome
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    9533 (POLR1C)
   00240 Pyrimidine metabolism
    9533 (POLR1C)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    9533 (POLR1C)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    9533 (POLR1C)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    9533 (POLR1C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     9533 (POLR1C)
  RNA polymerase I system
   RNA polymerase I
     9533 (POLR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 9533
NCBI-ProteinID: NP_976035
OMIM: 610060
HGNC: 20194
Ensembl: ENSG00000171453
Vega: OTTHUMG00000014739
Pharos: O15160(Tbio)
UniProt: O15160
LinkDB All DBs
Position
6p21.1
AA seq 346 aa AA seqDB search
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPR
LFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGN
QADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDIT
LLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttctcaggcggtggaggaaatgcggagccgcgtggttctgggggagtttggg
gttcgcaatgtccatactactgactttcccggtaactattccggttatgatgatgcctgg
gaccaggaccgcttcgagaagaatttccgtgtggatgtagtacacatggatgaaaactca
ctggagtttgacatggtgggaattgacgcagccattgccaatgcttttcgacgaattctg
ctagctgaggtgccaactatggctgtggagaaggtcctggtgtacaataatacatccatt
gttcaggatgagattcttgctcaccgtctggggctcattcccattcatgctgatccccgt
ctttttgagtatcggaaccaaggagatgaagaaggcacagagatagatactctacagttt
cgtctccaggtcagatgcactcggaacccccatgctgctaaagattcctctgaccccaac
gaactgtacgtgaaccacaaagtgtataccaggcatatgacatggatccccctggggaac
caggctgatctctttccagagggcactatccgaccagtgcatgatgatatcctcatcgct
cagctgcggcctggccaagaaattgacctgctcatgcactgtgtcaagggcattggcaaa
gatcatgccaagttttcaccagtggcaacagccagttacaggctcctgccagacatcacc
ctgcttgagcccgtggaaggggaggcagctgaggagttgagcaggtgcttctcacctggt
gttattgaggtgcaggaagtccaaggtaaaaaggtggccagagttgccaacccccggctg
gataccttcagcagagaaatcttccggaatgagaagctaaagaaggttgtgaggcttgcc
cgggttcgagatcattatatcttctctgttgagtcaacgggggtgttgccaccagatgtg
ctggtgagtgaagccatcaaagtactgatggggaagtgccggcgcttcttggatgaacta
gatgcggttcagatggactga

DBGET integrated database retrieval system