KEGG   Homo sapiens (human): 9541
Entry
9541              CDS       T01001                                 

Gene name
CIR1, CIR
Definition
(RefSeq) corepressor interacting with RBPJ, CIR1
  KO
K06066  CBF1 interacting corepressor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    9541 (CIR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    9541 (CIR1)
SSDB
Motif
Pfam: Cir_N
Other DBs
NCBI-GeneID: 9541
NCBI-ProteinID: NP_004873
OMIM: 605228
HGNC: 24217
Ensembl: ENSG00000138433
Vega: OTTHUMG00000132338
Pharos: Q86X95(Tdark)
UniProt: Q86X95
LinkDB
Position
2q31.1
AA seq 450 aa
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDR
KKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCS
GHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSR
THKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggggaaatccttcgccaacttcatgtgcaagaaagactttcatcctgcctccaaatcc
aatatcaaaaaagtatggatggcagaacagaaaatatcatatgataagaagaaacaagaa
gaattgatgcagcaatatcttaaagaacaagaatcatatgataatagattgcttatggga
gatgaacgtgtaaagaatggccttaatttcatgtatgaagccccaccaggagctaaaaaa
gaaaacaaagagaaagaagaaacagaaggagagaccgaatacaaatttgaatggcagaaa
ggagccccacgagaaaaatatgccaaagatgacatgaacatcagagatcagccctttggt
attcaggttcgaaatgtgaggtgcattaaatgtcacaaatggggtcatgtcaacacagat
cgagaatgtcctttgtttggtctttctggaatcaatgcaagttcggttcccactgatggc
tcagggccatcgatgcacccctcggagctaatagcggagatgagaaacagtgggtttgca
ctgaaacgaaatgtactggggagaaacttgaccgcaaatgatccatcacaggagtatgtt
gcaagtgagggtgaagaagatccagaagttgaatttttaaagtcactaacaaccaaacaa
aaacagaaacttctcaggaaattagatcgactggagaagaaaaaaaagaaaaaagataga
aaaaagaaaaagtttcagaagagcagaagtaaacacaaaaaacataagtcctcttcttcc
tcatcttcctcctcctcctcctcttcctctactgagacttcagaaagcagtagtgagagt
gagagtaacaataaagaaaaaaaaatacaaaggaagaaaagaaagaaaaacaagtgttca
gggcataacaacagtgattctgaagagaaggacaagtctaagaagagaaagcttcatgaa
gaactttctagcagtcaccataaccgggaaaaagccaaggaaaagcccaggttcttaaaa
cacgagagttctagggaggacagcaaatggagccattctgattctgacaaaaagtccaga
acccataaacatagcccagagaagagaggctctgaaagaaaggaggggagcagcagaagc
cacggcagggaggaaaggagccggagaagccggagcagaagtcctggtagttacaagcaa
agggagacaaggaaacgggcacagcgaaatcctggtgaagagcaaagcagaagaaatgac
agcagaagccatggcacagacttgtatagaggagaaaaaatgtacagagagcacccagga
ggtacacatactaaagtgacacaaagagaatga

DBGET integrated database retrieval system