KEGG   Homo sapiens (human): 9554Help
Entry
9554              CDS       T01001                                 

Gene name
SEC22B, ERS-24, SEC22L1
Definition
(RefSeq) SEC22 homolog B, vesicle trafficking protein (gene/pseudogene)
  KO
K08517  vesicle transport protein SEC22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04145  Phagosome
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9554 (SEC22B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9554 (SEC22B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    9554 (SEC22B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9554 (SEC22B)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    9554 (SEC22B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Longin Synaptobrevin IMD Sec20
Motif
Other DBs
NCBI-GeneID: 9554
NCBI-ProteinID: NP_004883
OMIM: 604029
HGNC: 10700
Ensembl: ENSG00000265808
Vega: OTTHUMG00000185008
Pharos: O75396(Tdark)
UniProt: O75396
LinkDB All DBs
Structure
PDB: 

Position
1p12
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctaacaatgatcgcccgagtggcggacgggctcccgctggccgcctcgatg
caggaggacgaacagtctggccgggaccttcaacaatatcagagtcaggctaagcaactc
tttcgaaagttgaatgaacagtcccctaccagatgtaccttggaagcaggagccatgact
tttcactacattattgagcagggggtgtgttatttggttttatgtgaagctgccttccct
aagaagttggcttttgcctacctagaagatttgcactcagaatttgatgaacagcatgga
aagaaggtgcccactgtgtcccgaccctattcctttattgaatttgatactttcattcag
aaaaccaagaagctctacattgacagtcgtgctcgaagaaatctaggctccatcaacact
gaattgcaagatgtgcagaggatcatggtggccaatattgaagaagtgttacaacgagga
gaagcactctcagcattggattcaaaggctaacaatttgtccagtctgtccaagaaatac
cgccaggatgcgaagtacttgaacatgcgttccacttatgccaaacttgcagcagtagct
gtatttttcatcatgttaatagtgtatgtccgattctggtggctgtga

DBGET integrated database retrieval system