KEGG   Homo sapiens (human): 9610Help
Entry
9610              CDS       T01001                                 

Gene name
RIN1
Definition
(RefSeq) Ras and Rab interactor 1
  KO
K17638  Ras and Rab interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    9610 (RIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9610 (RIN1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    9610 (RIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS9 RA SH2
Motif
Other DBs
NCBI-GeneID: 9610
NCBI-ProteinID: NP_004283
OMIM: 605965
HGNC: 18749
Ensembl: ENSG00000174791
Vega: OTTHUMG00000167085
Pharos: Q13671(Tbio)
UniProt: Q13671 A0A0S2Z4U0
LinkDB All DBs
Position
11q13.2
AA seq 783 aa AA seqDB search
MESPGESGAGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRE
RLLLTRPVWLQLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSH
YILESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAIHHAATHKELEAISHL
GIEFWSSSLNIKAQRGPAGGPVLPQLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREK
FKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTERLPPCQLLRRESSVGYRVPAG
SGPSLPPMPSLQEVDCGSPSSSEEEGVPGSRGSPATSPHLGRRRPLLRSMSAAFCSLLAP
ERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPE
KLLSPKRLEHVLEKSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAF
GSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFL
PLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPL
SPVQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCA
TKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSG
QSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSRA
AEE
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccctggagagtcaggcgcgggctctcctggagcccccagcccgtccagcttc
actactgggcacctggcgagagaaaagccagcccaggacccactgtatgacgtgcccaat
gccagcggcgggcaggcaggcgggccgcagcggccggggcgcgttgtgagcctgcgggag
cgcctgctgctcacccggcccgtgtggctgcagctgcaagccaacgcagcggccgcactg
cacatgctgaggaccgagcccccggggacgttcctcgtgcggaaatctaacacccgccag
tgccaggccctgtgcatgcggttgcctgaagccagtggcccctccttcgtctccagccac
tacatcctggagagccctggcggcgtctccttggagggctcggagctcatgttcccagac
ctagtccagctcatctgtgcctactgccacacccgggacatccttctcctcccgctgcag
ctccccagagccatccaccacgcagccactcacaaagagctggaggccatctcccatctg
ggcattgagttctggagctcctccctcaacatcaaggctcagcggggcccggctggaggc
ccagtgttgccccagctgaaggcccggtcccctcaagagctggaccagggcaccggagcc
gccttgtgcttcttcaaccccctgttcccgggggacctagggcccaccaagcgggagaaa
ttcaagagaagcttcaaagtgcgcgtgtccacagagacctccagccccctgtctccacct
gccgtgccacctccccccgtccccgtgctgccaggggcagtccccagccagacagagcgg
ctgcccccttgccagctgctacggagggagagctcagtggggtaccgcgtgccagcaggc
agtggccctagccttccgcctatgccctccctccaagaggtggactgcggctcccccagc
agctccgaggaggagggggtgccagggtcccgggggagcccagcgacctcaccccacctg
ggccgccgacgacctctgcttcggtccatgagcgccgccttctgctccctactggcaccg
gagcggcaggtgggccgggctgcggcagcactgatgcaggaccgacacacagccgcgggc
cagctggtgcaggacctactgacccaggtgcgggctgggcccgagccccaggagctgcag
ggcatccgtcaggcgctgagccgggcccgggccatgctgagtgcggagctgggccctgag
aagctgctgtcgcctaagaggctggaacatgtcctggagaagtcattgcattgctctgtg
ctcaagcctctccggcccatcctggcagcccgcctgcggcgccggcttgccgcagacggc
tccctgggccgcctagctgagggcctccgcctggcccgggcccagggccccggagccttc
gggtcccacctgagcctgccctccccagtagagttggagcaagtgcgccagaagctgctg
cagctgctccgcacctactcacccagcgcccaggtcaagcggctcctgcaggcctgcaag
ctgctctacatggccctgaggacccaggaaggggagggcgcgggtgccgacgagttcctg
cctctgctgagcctcgtcttggcccactgtgaccttcctgagctgctgctggaggccgag
tacatgtcggagctgctggagcccagcctgcttactggagagggtggctactacctgacc
agcctctctgccagcctggccctgctgagtggcctgggtcaggcccacaccctcccactg
agccccgtgcaggagctacggcgctccctcagcctctgggagcagcgccgcctgcctgcc
acccactgcttccagcacctcctccgagtagcctatcaggatcccagcagtggctgcacc
tccaagaccctggccgtgcccccagaagcctcgattgccaccctgaaccagctctgtgcc
accaagttccgagtgacccagcccaacacttttggcctcttcctgtacaaggagcagggc
taccaccgcctgccccctggggccctggcccacaggctgcccaccactggctacctcgtc
taccgccgggcggagtggcctgagacccagggggctgtgacagaggaggagggcagtggg
cagtcagaggcaagaagcagaggggaggagcaagggtgccagggagatggggatgctggg
gtcaaagccagccccagggacattcgggaacagtctgagacaactgctgaagggggccag
ggtcaagcccaggaaggccctgctcagccaggggaaccagaggcagagggaagccgggca
gcagaggagtag

DBGET integrated database retrieval system