KEGG   Homo sapiens (human): 9616
Entry
9616              CDS       T01001                                 

Gene name
RNF7, CKBBP1, ROC2, SAG, rbx2
Definition
(RefSeq) ring finger protein 7
  KO
K10611  RING-box protein 2 [EC:2.3.2.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9616 (RNF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9616 (RNF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9616 (RNF7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     9616 (RNF7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Ring finger protein
     9616 (RNF7)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4
Other DBs
NCBI-GeneID: 9616
NCBI-ProteinID: NP_055060
OMIM: 603863
HGNC: 10070
Ensembl: ENSG00000114125
Vega: OTTHUMG00000141305
Pharos: Q9UBF6(Tbio)
UniProt: Q9UBF6
LinkDB
Structure
PDB: 
2ECL

Position
3q23
AA seq 113 aa
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccgacgtggaagacggagaggaaacctgcgccctggcctctcactccgggagctca
ggctccaagtcgggaggcgacaagatgttctccctcaagaagtggaacgcggtggccatg
tggagctgggacgtggagtgcgatacgtgcgccatctgcagggtccaggtgatggatgcc
tgtcttagatgtcaagctgaaaacaaacaagaggactgtgttgtggtctggggagaatgt
aatcattccttccacaactgctgcatgtccctgtgggtgaaacagaacaatcgctgccct
ctctgccagcaggactgggtggtccaaagaatcggcaaatga

DBGET integrated database retrieval system