KEGG   Homo sapiens (human): 9627
Entry
9627              CDS       T01001                                 

Gene name
SNCAIP, SYPH1, Sph1
Definition
(RefSeq) synuclein alpha interacting protein
  KO
K04558  synphilin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06463  Parkinson disease
  Element
N01025  Parkin-mediated ubiquitination
N01026  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    9627 (SNCAIP)
   05022 Pathways of neurodegeneration - multiple diseases
    9627 (SNCAIP)
SSDB
Motif
Pfam: SNCAIP_SNCA_bd Ank_2 Ank_4 Ank_5 Ank Lzipper-MIP1
Other DBs
NCBI-GeneID: 9627
NCBI-ProteinID: NP_005451
OMIM: 603779
HGNC: 11139
Ensembl: ENSG00000064692
Vega: OTTHUMG00000128915
Pharos: Q9Y6H5(Tbio)
UniProt: Q9Y6H5
LinkDB
Structure
PDB: 
2KES

Position
5q23.2
AA seq 919 aa
MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNT
QKPTGIADVYSKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQEL
GPGDGVGGPPGKSSEPSTSLGELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGL
CTTINGLSGKACSTGSSESSSSNMAPFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISP
PLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSG
LNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENGNNLLHIAASQ
GHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDF
PSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYG
ANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQ
NQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGS
LSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKR
ELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLM
IKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQ
PSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDK
GRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRK
TDAKGNPASSASKGKNKAA
NT seq 2760 nt   +upstreamnt  +downstreamnt
atggaagcccctgaataccttgatttggatgaaattgactttagtgatgacatatcttat
tcagtcacatcactcaagacgatcccagaactgtgccgaagatgtgatacgcaaaacgaa
gacagatcagtttctagctctagctggaattgtggcatctcaactcttattacaaacacg
caaaagcccacaggaatcgctgatgtgtacagtaagttccgcccagtgaagcgggtttcg
ccactgaaacatcagccagagactctggagaacaatgaaagtgatgaccaaaagaaccag
aaagtggttgagtaccagaaagggggtgagtctgacctgggcccccagcctcaggagctt
ggccctggagatggagtgggcggcccaccaggtaagagctctgagcccagcacatcgctg
ggtgaactggagcactacgacctcgacatggatgagattctggatgtgccttatattaaa
tccagtcagcagcttgcctcttttaccaaggtgacttcagaaaaaagaattttgggctta
tgcacaaccatcaatggcctttctggcaaagcctgctctacaggaagttctgagagctca
tcatccaacatggcaccattttgtgttctttctcccgtgaaaagccctcacttgagaaaa
gcatcagctgtcatccacgaccagcacaagctgtccactgaagaaaccgagatctcacct
cctctggttaaatgtggctctgcatatgagcctgaaaaccagagtaaagacttcctaaac
aagacatttagtgatcctcatggtcgaaaagttgagaagacaacaccagactgccagctc
agggccttccacctacaatcctcagcagcagaatccaaaccagaagagcaggtcagtggc
ctaaaccggaccagctcccaaggcccagaagaaaggagtgagtatctgaaaaaagtgaaa
agcatcttgaacattgttaaagaaggacagatctctctcctgccacacctagctgcagac
aatctagacaaaattcacgacgaaaatggaaacaatctattacatattgcggcgtcacag
ggacacgcagagtgtctacagcacctcacttctttgatgggagaagactgcctcaatgag
cgcaacactgagaagttgactccagcaggcctggccattaagaatggtcagttggagtgc
gtacgctggatggtgagcgaaacagaagccattgcagaactgagttgttctaaggatttt
ccaagccttattcattacgcaggttgctatggccaggaaaagattcttctgtggcttctt
cagtttatgcaagaacagggcatctcgttggatgaagtagaccaggatggcaacagtgcc
gttcacgtagcctcacagcatggctaccttggatgcatacagaccttggttgaatatgga
gcaaatgtcaccatgcagaaccacgctggggaaaagccctcccagagcgccgagcggcag
gggcacaccctgtgctccaggtacctggtggtggtggagacctgcatgtcgctggcctct
caagtggtgaagttaaccaagcagctaaaggaacaaacagtagaacgtgtcacgctgcag
aaccaactccaacaatttctagaagcccagaaatcagagggcaagtcactcccttcttca
cccagttcaccatcctcacctgcctccagaaagtcccagtggaaatctccagatgcagat
gatgattctgtagccaaaagcaagccaggagtccaagaggggattcaggttcttggaagc
ctgtcagcctccagccgggctagacccaaagcaaaagatgaagattctgataaaatctta
cgccagttattgggaaaggaaatctcagaaaatgtctgcacccaggaaaaactgtccttg
gaattccaggatgctcaggcttcctctagaaattctaaaaagatcccactggagaagagg
gaactgaagttagccaggctgagacagctgatgcagaggtcactgagtgagtctgacaca
gactccaacaactctgaggaccccaagactaccccagtgaggaaggctgaccgaccaagg
ccgcagcccattgtagaaagcgtagagagtatggacagcgcagaaagcctgcacctgatg
attaagaaacacaccttggcatcagggggacgcaggtttcctttcagcatcaaggcctcc
aaatccctggatggccacagcccatctcccacctcagagagcagcgaaccagacttagaa
tcccagtatccaggctcagggagtattcctccaaaccagccctctggtgaccctcagcag
cccagccctgacagtactgctgcccagaaagttgccacaagtcccaagagtgccctcaag
tctccatcttccaagcgtaggacatctcagaacttaaaactgagagttacctttgaggag
cctgtggtgcagatggagcagcctagccttgaactgaatggagaaaaagacaaagataag
ggcaggactctccagcggacctccacaagtaacgaatcgggggatcaactgaaaaggcct
tttggagcctttcgatctatcatggagacactaagtggcaaccaaaacaataataataac
taccaggcagccaaccagctgaaaacctctacattgcccttgacctcacttgggaggaag
acagatgccaagggaaaccctgccagctccgctagcaaaggaaagaataaggcagcataa

DBGET integrated database retrieval system