KEGG   Homo sapiens (human): 9635Help
Entry
9635              CDS       T01001                                 

Gene name
CLCA2, CACC, CACC3, CLCRG2, CaCC-3
Definition
(RefSeq) chloride channel accessory 2
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04924  Renin secretion
hsa04972  Pancreatic secretion
Drug target
Niflumic acid: D08275
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    9635 (CLCA2)
  09154 Digestive system
   04972 Pancreatic secretion
    9635 (CLCA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9635 (CLCA2)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   9635 (CLCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLCA VWA_2 SusE
Motif
Other DBs
NCBI-GeneID: 9635
NCBI-ProteinID: NP_006527
OMIM: 604003
HGNC: 2016
Ensembl: ENSG00000137975
Vega: OTTHUMG00000010256
Pharos: Q9UQC9(Tbio)
UniProt: Q9UQC9
LinkDB All DBs
Position
1p22.3
AA seq 943 aa AA seqDB search
MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISN
IKEMITEASFYLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAH
GDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNND
KPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQNATASI
MFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVITDSADFHHSFPMNGTELPPPP
TFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEI
RAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAF
SRISSGTGDIFQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIIL
FDPDGRKYYTNNFITNLTFRTASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNS
AVPPATVEAFVERDSLHFPHPVMIYANVKQGFYPILNATVTATVEPETGDPVTLRLLDDG
AGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGN
IQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKIIDLEAVKVEEE
LTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDY
LILKGVLTAMGLIGIICLIIVVTHHTLSRKKRADKKENGTKLL
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaggagcattgcaggtcctatttgcaacctgaagtttgtgactctcctggtt
gccttaagttcagaactcccattcctgggagctggagtacagcttcaagacaatgggtat
aatggattgctcattgcaattaatcctcaggtacctgagaatcagaacctcatctcaaac
attaaggaaatgataactgaagcttcattttacctatttaatgctaccaagagaagagta
tttttcagaaatataaagattttaatacctgccacatggaaagctaataataacagcaaa
ataaaacaagaatcatatgaaaaggcaaatgtcatagtgactgactggtatggggcacat
ggagatgatccatacaccctacaatacagagggtgtggaaaagagggaaaatacattcat
ttcacacctaatttcctactgaatgataacttaacagctggctacggatcacgaggccga
gtgtttgtccatgaatgggcccacctccgttggggtgtgttcgatgagtataacaatgac
aaacctttctacataaatgggcaaaatcaaattaaagtgacaaggtgttcatctgacatc
acaggcatttttgtgtgtgaaaaaggtccttgcccccaagaaaactgtattattagtaag
ctttttaaagaaggatgcacctttatctacaatagcacccaaaatgcaactgcatcaata
atgttcatgcaaagtttatcttctgtggttgaattttgtaatgcaagtacccacaaccaa
gaagcaccaaacctacagaaccagatgtgcagcctcagaagtgcatgggatgtaatcaca
gactctgctgactttcaccacagctttcccatgaatgggactgagcttccacctcctccc
acattctcgcttgtacaggctggtgacaaagtggtctgtttagtgctggatgtgtccagc
aagatggcagaggctgacagactccttcaactacaacaagccgcagaattttatttgatg
cagattgttgaaattcataccttcgtgggcattgccagtttcgacagcaaaggagagatc
agagcccagctacaccaaattaacagcaatgatgatcgaaagttgctggtttcatatctg
cccaccactgtatcagctaaaacagacatcagcatttgttcagggcttaagaaaggattt
gaggtggttgaaaaactgaatggaaaagcttatggctctgtgatgatattagtgaccagc
ggagatgataagcttcttggcaattgcttacccactgtgctcagcagtggttcaacaatt
cactccattgccctgggttcatctgcagccccaaatctggaggaattatcacgtcttaca
ggaggtttaaagttctttgttccagatatatcaaactccaatagcatgattgatgctttc
agtagaatttcctctggaactggagacattttccagcaacatattcagcttgaaagtaca
ggtgaaaatgtcaaacctcaccatcaattgaaaaacacagtgactgtggataatactgtg
ggcaacgacactatgtttctagttacgtggcaggccagtggtcctcctgagattatatta
tttgatcctgatggacgaaaatactacacaaataattttatcaccaatctaacttttcgg
acagctagtctttggattccaggaacagctaagcctgggcactggacttacaccctgaac
aatacccatcattctctgcaagccctgaaagtgacagtgacctctcgcgcctccaactca
gctgtgcccccagccactgtggaagcctttgtggaaagagacagcctccattttcctcat
cctgtgatgatttatgccaatgtgaaacagggattttatcccattcttaatgccactgtc
actgccacagttgagccagagactggagatcctgttacgctgagactccttgatgatgga
gcaggtgctgatgttataaaaaatgatggaatttactcgaggtattttttctcctttgct
gcaaatggtagatatagcttgaaagtgcatgtcaatcactctcccagcataagcacccca
gcccactctattccagggagtcatgctatgtatgtaccaggttacacagcaaacggtaat
attcagatgaatgctccaaggaaatcagtaggcagaaatgaggaggagcgaaagtggggc
tttagccgagtcagctcaggaggctccttttcagtgctgggagttccagctggcccccac
cctgatgtgtttccaccatgcaaaattattgacctggaagctgtaaaagtagaagaggaa
ttgaccctatcttggacagcacctggagaagactttgatcagggccaggctacaagctat
gaaataagaatgagtaaaagtctacagaatatccaagatgactttaacaatgctatttta
gtaaatacatcaaagcgaaatcctcagcaagctggcatcagggagatatttacgttctca
ccccaaatttccacgaatggacctgaacatcagccaaatggagaaacacatgaaagccac
agaatttatgttgcaatacgagcaatggataggaactccttacagtctgctgtatctaac
attgcccaggcgcctctgtttattccccccaattctgatcctgtacctgccagagattat
cttatattgaaaggagttttaacagcaatgggtttgataggaatcatttgccttattata
gttgtgacacatcatactttaagcaggaaaaagagagcagacaagaaagagaatggaaca
aaattattataa

DBGET integrated database retrieval system