KEGG   Homo sapiens (human): 9663
Entry
9663              CDS       T01001                                 

Gene name
LPIN2
Definition
(RefSeq) lipin 2
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04150  mTOR signaling pathway
Module
hsa_M00089  Triacylglycerol biosynthesis
Disease
H01117  Chronic recurrent multifocal osteomyelitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    9663 (LPIN2)
   00564 Glycerophospholipid metabolism
    9663 (LPIN2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    9663 (LPIN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9663 (LPIN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     9663 (LPIN2)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   9663 (LPIN2)
SSDB
Motif
Pfam: LNS2 Lipin_N Lipin_mid WRNPLPNID
Other DBs
NCBI-GeneID: 9663
NCBI-ProteinID: NP_055461
OMIM: 605519
HGNC: 14450
Ensembl: ENSG00000101577
Vega: OTTHUMG00000131508
Pharos: Q92539(Tbio)
UniProt: Q92539
LinkDB
Position
18p11.31
AA seq 896 aa
MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQFFKDIDT
PLVKSGGDETPSQSSDISHVLETETIFTPSSVKKKKRRRKKYKQDSKKEEQAASAAAEDT
CDVGVSSDDDKGAQAARGSSNASLKEEECKEPLLFHSGDHYPLSDGDWSPLETTYPQTAC
PKSDSELEVKPAESLLRSESHMEWTWGGFPESTKVSKRERSDHHPRTATITPSENTHFRV
IPSEDNLISEVEKDASMEDTVCTIVKPKPRALGTQMSDPTSVAELLEPPLESTQISSMLD
ADHLPNAALAEAPSESKPAAKVDSPSKKKGVHKRSQHQGPDDIYLDDLKGLEPEVAALYF
PKSESEPGSRQWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSEN
GEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPK
ATVESWVKDKMPKKSGRWWFWRKRESMTKQLPESKEGKSEAPPASDLPSSSKEPAGARPA
ENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYKKSLRLSSDQIAKLKLHDGPNDVVF
SITTQYQGTCRCAGTIYLWNWNDKIIISDIDGTITKSDALGQILPQLGKDWTHQGIAKLY
HSINENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSLFSAFHREVIE
KKPEKFKIECLNDIKNLFAPSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQ
ERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPEVDLDDLS
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgaattatgtgggacagctggctgggcaggtgattgtcactgtgaaggaactctacaag
ggcattaaccaggccaccctctctgggtgcattgatgtcatcgtggtacagcagcaggat
ggcagctatcagtgttcaccttttcacgttcggtttggaaagctgggagtcctgagatcc
aaagagaaagtgattgatatagaaatcaacggcagtgcagtggatcttcacatgaagttg
ggtgataacggagaagctttctttgttgaggagactgaagaagaatatgaaaagcttcct
gcttaccttgccacctcaccaattcctactgaagatcagttctttaaagatattgacacc
cctttggtgaaatcgggtggagatgaaacaccatctcagagttcagacatctcacacgtc
ttggaaacagagacaatttttactccaagttctgtgaaaaagaaaaaacgaaggagaaag
aaatacaaacaggacagtaagaaggaagagcaggccgcatctgctgctgcagaagacaca
tgtgatgtaggcgtgagctccgatgatgacaagggggcccaggcagcacgaggatcttca
aatgcttccttgaaagaagaagaatgtaaagagcctttgctcttccattctggggatcat
taccccttatctgatggagattggtcccctttagagaccacctatccccagacagcgtgt
cctaagagtgattcagagctggaggtgaaacctgcggagagcctgctcagatcagagtct
cacatggagtggacgtggggcggattcccagagtccaccaaggtcagcaaaagagaacga
tctgaccatcatcctaggacagctacaattacaccatcagaaaatactcattttcgggta
attcccagtgaggacaacctcatcagtgaagttgagaaggatgcttccatggaagacact
gtctgtaccatagtgaagcccaaacccagagccctgggtacacagatgagcgacccaaca
tctgtggcagagcttctcgaacctcctcttgagagtactcagatttcatctatgttagat
gctgaccaccttcccaacgcagccttagcggaggcgccctcagaatccaaaccggcagct
aaagtagactcgccgtcaaagaagaaaggtgttcacaaaagaagccaacaccagggacct
gatgatatttaccttgatgacttaaagggtctagaacctgaagttgcagctctttatttc
cctaaaagtgaatcggagcccggttccaggcagtggcccgagtctgacacactctctggc
tcccagtccccacagtccgtgggaagcgcagctgcagatagcggcaccgagtgcctctca
gattctgccatggacttgcctgacgttaccctctccctttgcgggggcctcagtgaaaat
ggagaaatttcaaaagaaaaattcatggagcatatcattacttatcacgaatttgcagaa
aaccctggacttatagacaatcctaaccttgtaataaggatatataatcgttactataac
tgggctttggcagctcccatgatccttagcttgcaagtattccagaagagcttgcctaag
gccacagttgagtcctgggtgaaagacaagatgccaaagaaatctggtcgctggtggttt
tggcgaaagagagaaagcatgaccaaacagctgccagaatccaaggagggaaaatctgag
gcaccgccagccagtgacctgccatccagctccaaggagccggccggtgccaggccggcc
gagaatgactcctcgagtgacgagggatcacaggagctcgaagaatccatcacagtggac
cccatccccacagagcccctgagccacggcagcacaacttcatataagaagtctctccgc
ctctcctcagaccagatcgcaaaactgaagctccacgatggcccaaatgatgttgtgttt
agtattacaacccagtatcaaggcacctgtcgctgtgcagggaccatttacctgtggaac
tggaatgacaagatcatcatttctgatattgatgggacaataaccaagtcggatgctttg
ggacagattctcccacagctgggcaaagactggacccaccagggtatagcaaagctctac
cattccatcaatgagaatggctacaagtttctgtactgctcggctcgtgccatcggcatg
gccgacatgacccgtggctacctgcactgggtcaatgacaagggcacaatcttgccccgg
ggccccctgatgctgtcccccagcagcttgttctccgccttccacagagaagtgatagaa
aagaaaccagagaagttcaaaattgagtgtctaaatgatatcaagaatctgtttgccccg
tctaagcagcccttctatgctgcctttggaaaccgtccaaatgatgtctatgcctacaca
caagttggagttccagactgtagaatattcaccgtgaaccccaagggtgaattaatacaa
gaaagaaccaaaggaaacaagtcatcgtatcacaggctgagtgagctcgtggagcatgtg
ttcccccttctcagtaaggagcagaattccgcttttccctgcccggagttcagctccttc
tgctactggcgagacccgatccctgaagtggacctggatgacctgtcttga

DBGET integrated database retrieval system